Mustela putorius furo (domestic ferret): 101684104 Help Entry 101684104         CDS       T07239                                  Symbol POLE3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf03030   DNA replication mpuf03082   ATP-dependent chromatin remodeling mpuf03410   Base excision repair mpuf03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mpuf00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     101684104 (POLE3)    03410 Base excision repair     101684104 (POLE3)    03420 Nucleotide excision repair     101684104 (POLE3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101684104 (POLE3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mpuf03032]     101684104 (POLE3)    03036 Chromosome and associated proteins [BR:mpuf03036]     101684104 (POLE3)    03400 DNA repair and recombination proteins [BR:mpuf03400]     101684104 (POLE3) Enzymes [BR:mpuf01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      101684104 (POLE3) DNA replication proteins [BR:mpuf03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     101684104 (POLE3) Chromosome and associated proteins [BR:mpuf03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     101684104 (POLE3) DNA repair and recombination proteins [BR:mpuf03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       101684104 (POLE3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C CIS_TMP BUD22 DUF5427 SpoU_methylase TAF DUF4746 RNA_pol_3_Rpc31 Myc_N Pox_Ag35 DDHD CDC45 DUF6080 V_ATPase_I NOA36 Motif Other DBs NCBI-GeneID:  101684104 NCBI-ProteinID:  XP_004747907 Ensembl:  ENSMPUG00000007925 UniProt:  M3Y960 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGK RKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDAEEQD KSRDEDNEEDEERLEEEEQNEEEEVDN NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggcggagaggcccgaggacctaaacctgcccaatgccgtcatcacgaggatcatcaag gaagcgctcccggacggtgtcaacatttccaaggaggcccgcagcgccatctcccgcgcc gccagcgtcttcgtgctgtacgccacttcctgcgccaacaacttcgcgatgaaagggaaa cgcaagaccctgaatgccagtgacgtgctctcggccatggaagagatggagttccagcgg ttcgttaccccgttgaaagaagctctggaagcatacaggagagagcagaaaggcaaaaag gaagcttcagagcaaaagaagaaggacaaagacaagaaaacagatgcagaagagcaagac aagagcagggatgaggacaacgaggaagacgaggaaaggctggaagaagaggaacagaat gaagaggaggaagtggacaactaa

DBGET integrated database retrieval system