Mustela putorius furo (domestic ferret): 101684840 Help Entry 101684840         CDS       T07239                                  Symbol CAV3 Name (RefSeq) caveolin-3   KO K12959   caveolin 3 Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04144   Endocytosis mpuf04510   Focal adhesion mpuf05020   Prion disease mpuf05100   Bacterial invasion of epithelial cells mpuf05205   Proteoglycans in cancer mpuf05410   Hypertrophic cardiomyopathy mpuf05412   Arrhythmogenic right ventricular cardiomyopathy mpuf05414   Dilated cardiomyopathy mpuf05416   Viral myocarditis mpuf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101684840 (CAV3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101684840 (CAV3)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     101684840 (CAV3)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     101684840 (CAV3)   09164 Neurodegenerative disease    05020 Prion disease     101684840 (CAV3)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101684840 (CAV3)    05410 Hypertrophic cardiomyopathy     101684840 (CAV3)    05412 Arrhythmogenic right ventricular cardiomyopathy     101684840 (CAV3)    05414 Dilated cardiomyopathy     101684840 (CAV3)    05416 Viral myocarditis     101684840 (CAV3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpuf04131]     101684840 (CAV3) Membrane trafficking [BR:mpuf04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     101684840 (CAV3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  101684840 NCBI-ProteinID:  XP_004738486 Ensembl:  ENSMPUG00000017061 UniProt:  M3Z042 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI YSLCIRTFCNPLFAALGQICSNIKVMLRKEV NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgatggccgaagagcacacagacctggaggcccagattgtcaaggacatccactgcaag gagatcgacctggtgaaccgagaccctaagaacattaacgaggacatcgtgaaggtggat tttgaagacgtgattgcagaacccgtgggcacctacagttttgacggcgtgtggaaggtg agctacaccaccttcacggtctccaagtactggtgctaccgcctgctgtccacgctgctg ggggtcccgctggccctgctctggggcttcctgttcgcctgcatctccttctgccacatc tgggcggtggtgccttgcattaagagttacctgatcgagatccagtgcatcagtcacatc tactccctctgcatccgtaccttctgcaaccctctctttgctgccctgggccagatctgc agcaacatcaaggtcatgctgcggaaggaagtgtaa

DBGET integrated database retrieval system