Mustela putorius furo (domestic ferret): 101685458 Help Entry 101685458         CDS       T07239                                  Symbol DEFB1 Name (RefSeq) beta-defensin 1   KO K23125   beta-defensin 1 Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf02010   ABC transporters mpuf05150   Staphylococcus aureus infection Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     101685458 (DEFB1)  09160 Human Diseases   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     101685458 (DEFB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mpuf02000]     101685458 (DEFB1)    03037 Cilium and associated proteins [BR:mpuf03037]     101685458 (DEFB1) Transporters [BR:mpuf02000]  Other transporters   Pores ion channels [TC:1]    101685458 (DEFB1) Cilium and associated proteins [BR:mpuf03037]  Motile cilia and associated proteins   Sperm associated proteins    101685458 (DEFB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Defensin_beta Motif Other DBs NCBI-GeneID:  101685458 NCBI-ProteinID:  XP_004766803 UniProt:  A0A8U0N546 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MRALSFLLLILCLVSSHLAPGAGFLSGLGQRSDHYMCARKGGTCNFSPCPLFTRLEGTCY GGKAKCCMR NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagggctctctccttcctgctgctgattctgtgcctcgtctcctcccacctggcccca ggtgctggctttctcagcggtctcggccagaggtctgaccactacatgtgtgccaggaaa ggaggcacctgtaacttctccccctgcccgctcttcaccaggttggaaggcacctgttac ggtgggaaggccaagtgctgcatgcgttga

DBGET integrated database retrieval system