Mustela putorius furo (domestic ferret): 101686116 Help Entry 101686116         CDS       T07239                                  Name (RefSeq) interferon alpha-1/2-like   KO K05414   interferon alpha Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04060   Cytokine-cytokine receptor interaction mpuf04151   PI3K-Akt signaling pathway mpuf04217   Necroptosis mpuf04620   Toll-like receptor signaling pathway mpuf04621   NOD-like receptor signaling pathway mpuf04622   RIG-I-like receptor signaling pathway mpuf04623   Cytosolic DNA-sensing pathway mpuf04630   JAK-STAT signaling pathway mpuf04650   Natural killer cell mediated cytotoxicity mpuf04936   Alcoholic liver disease mpuf05152   Tuberculosis mpuf05160   Hepatitis C mpuf05161   Hepatitis B mpuf05162   Measles mpuf05163   Human cytomegalovirus infection mpuf05164   Influenza A mpuf05165   Human papillomavirus infection mpuf05167   Kaposi sarcoma-associated herpesvirus infection mpuf05168   Herpes simplex virus 1 infection mpuf05169   Epstein-Barr virus infection mpuf05170   Human immunodeficiency virus 1 infection mpuf05171   Coronavirus disease - COVID-19 mpuf05200   Pathways in cancer mpuf05320   Autoimmune thyroid disease mpuf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101686116    04151 PI3K-Akt signaling pathway     101686116   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101686116  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101686116  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101686116    04621 NOD-like receptor signaling pathway     101686116    04622 RIG-I-like receptor signaling pathway     101686116    04623 Cytosolic DNA-sensing pathway     101686116    04650 Natural killer cell mediated cytotoxicity     101686116  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101686116   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101686116    05161 Hepatitis B     101686116    05160 Hepatitis C     101686116    05171 Coronavirus disease - COVID-19     101686116    05164 Influenza A     101686116    05162 Measles     101686116    05168 Herpes simplex virus 1 infection     101686116    05163 Human cytomegalovirus infection     101686116    05167 Kaposi sarcoma-associated herpesvirus infection     101686116    05169 Epstein-Barr virus infection     101686116    05165 Human papillomavirus infection     101686116   09171 Infectious disease: bacterial    05152 Tuberculosis     101686116   09163 Immune disease    05320 Autoimmune thyroid disease     101686116   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101686116   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101686116  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpuf04052]     101686116 Cytokines and neuropeptides [BR:mpuf04052]  Cytokines   Interferons    101686116 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  101686116 NCBI-ProteinID:  XP_004761897 Ensembl:  ENSMPUG00000019513 UniProt:  A0A8U0SZ57 LinkDB All DBs Position Unknown AA seq 198 aa AA seqDB search MALPCSFLLALVVLSCHSLGSMGCDLPQDHGLLNWRALMLLRQMRRVSTFSCLRDRNDFA FPQEVFDGKPLQKAQAISVLHVTNQKTFHLFCTEASPAPWNTTLLEQLCSGLSEQMSHLA ACPLQEAGVGETPLVNGDSILRNYFQRISLYLQEKQYSHCAWEMVRAEIMKVFSSSTTLQ ERLRGKKQDLVQHGDDSH NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atggccctgccctgctccttcttgttggccctggtggtgctcagctgccactccctcggc tctatgggatgtgacctgcctcaggatcatggtctgctgaactggagggccttgatgctc ctgcgacaaatgaggagagtctccactttttcctgcctgagggacagaaatgactttgcc ttcccccaagaggtgtttgatggcaagccgctgcagaaggctcaagcaatctctgtcctc catgtgacgaaccagaagaccttccacctcttctgcacagaggcctcacctgctccctgg aacacgaccctcctggagcaattgtgctcaggactttctgagcagatgagccacctggca gcctgtcccctgcaggaggcgggggtgggagagacgcccctggtgaacggggactccatc ctgaggaactacttccagagaatctccctctatctgcaagagaagcaatacagccattgt gcctgggagatggtcagagcagagatcatgaaagttttctcttcatcaacaaccttgcaa gaaaggttaaggggcaagaaacaagacctggttcaacatggtgatgactctcactga

DBGET integrated database retrieval system