Mustela putorius furo (domestic ferret): 101686122 Help Entry 101686122         CDS       T07239                                  Symbol MRAS Name (RefSeq) ras-related protein M-Ras   KO K07831   Ras-related protein M-Ras Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04010   MAPK signaling pathway mpuf04014   Ras signaling pathway mpuf04015   Rap1 signaling pathway mpuf04072   Phospholipase D signaling pathway mpuf04137   Mitophagy - animal mpuf04140   Autophagy - animal mpuf04218   Cellular senescence mpuf04371   Apelin signaling pathway mpuf04625   C-type lectin receptor signaling pathway mpuf04810   Regulation of actin cytoskeleton mpuf05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101686122 (MRAS)    04014 Ras signaling pathway     101686122 (MRAS)    04015 Rap1 signaling pathway     101686122 (MRAS)    04371 Apelin signaling pathway     101686122 (MRAS)    04072 Phospholipase D signaling pathway     101686122 (MRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101686122 (MRAS)    04137 Mitophagy - animal     101686122 (MRAS)   09143 Cell growth and death    04218 Cellular senescence     101686122 (MRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101686122 (MRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101686122 (MRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     101686122 (MRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mpuf04031]     101686122 (MRAS) GTP-binding proteins [BR:mpuf04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101686122 (MRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 AAA_16 MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  101686122 NCBI-ProteinID:  XP_004762480 Ensembl:  ENSMPUG00000009182 UniProt:  M3YCP8 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP MILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIP EKSQKKKKKTKWRGDRATGTHKLQCVIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcaaccagtgcagtccccagtgacaacctccccacatacaagctggtggtggtggga gatgggggtgtgggcaagagtgccctcaccatccagtttttccagaagatctttgtgcct gactacgaccccaccattgaagactcctacctgaaacacacagagattgacaatcagtgg gccatcctggatgttctggacacagctgggcaggaggagttcagcgccatgcgggagcag tatatgcgcacgggggatggcttcctcatcgtcttctcagtcacggacaaggccagcttc gagcacgtggaccgcttccaccaactcatcctgcgtgtcaaggacagagagtcctttccg atgatcctcgtggccaacaaggtcgatctgatgcatttgaggaagatcaccagggagcaa ggaaaagaaatggcgaccaaacacaatattccatacatagaaaccagtgccaaggaccca cctctcaacgtggacaaagccttccatgacctggtcagggtaattaggcaacagattccg gaaaagagtcagaagaagaagaagaaaaccaaatggcggggagatcgggccactggcacc cacaaactgcagtgtgtgatattgtga

DBGET integrated database retrieval system