KEGG   Mustela putorius furo (domestic ferret): 101686313
Entry
101686313         CDS       T07239                                 
Symbol
NDUFS3
Name
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2]
Organism
mpuf  Mustela putorius furo (domestic ferret)
Pathway
mpuf00190  Oxidative phosphorylation
mpuf01100  Metabolic pathways
mpuf04714  Thermogenesis
mpuf04723  Retrograde endocannabinoid signaling
mpuf04932  Non-alcoholic fatty liver disease
mpuf05010  Alzheimer disease
mpuf05012  Parkinson disease
mpuf05014  Amyotrophic lateral sclerosis
mpuf05016  Huntington disease
mpuf05020  Prion disease
mpuf05022  Pathways of neurodegeneration - multiple diseases
mpuf05208  Chemical carcinogenesis - reactive oxygen species
mpuf05415  Diabetic cardiomyopathy
Module
mpuf_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mpuf00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101686313 (NDUFS3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101686313 (NDUFS3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101686313 (NDUFS3)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101686313 (NDUFS3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101686313 (NDUFS3)
   05012 Parkinson disease
    101686313 (NDUFS3)
   05014 Amyotrophic lateral sclerosis
    101686313 (NDUFS3)
   05016 Huntington disease
    101686313 (NDUFS3)
   05020 Prion disease
    101686313 (NDUFS3)
   05022 Pathways of neurodegeneration - multiple diseases
    101686313 (NDUFS3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101686313 (NDUFS3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101686313 (NDUFS3)
Enzymes [BR:mpuf01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     101686313 (NDUFS3)
SSDB
Motif
Pfam: Complex1_30kDa Trp_oprn_chp
Other DBs
NCBI-GeneID: 101686313
NCBI-ProteinID: XP_004763103
Ensembl: ENSMPUG00000003880
UniProt: A0A8U0N1M5
LinkDB
Position
Unknown
AA seq 269 aa
MAAAATAAAAAARGWWRGLMGSVALARGAGRPSVLLLPVRKESTAADTRPTVRPRDDVAH
KQLSAFGEYVAEILPKYVQQVQVSCFNELEICIHPDGVIPVLTFLRDHTNAQFKSLADLT
AVDIPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESTVSVFKAANWYEREIWDMFG
VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDL
NSPWEAFPAYRQPPESPKLEAGDKKPETK
NT seq 810 nt   +upstreamnt  +downstreamnt
atggcggcagcggcgacggcggcggcggcggcggcgaggggctggtggcggggccttatg
gggtccgtggcgctggccaggggggccgggcgaccttcggtgctgttgctgccggtgagg
aaggaaagcaccgcggccgacacgcgccccactgtcagaccacgggatgatgtggcccac
aagcagctctcagcatttggagagtatgtggctgaaattctgcccaagtatgtccagcaa
gttcaggtgtcttgcttcaatgagttagagatctgtatccatcctgatggagtcatccca
gtgctgactttcctcagggatcacaccaatgcacaattcaagtccttggctgacttgaca
gcagtggacatccccactcggcagaaccgttttgagattgtttacaacctgctttctctg
cgcttcaactctcggatccgtgtgaagacctacacagatgagctgacacccatcgagtcc
acggtttctgtgttcaaggcagctaactggtatgagagggagatctgggacatgtttgga
gtcttctttgctaaccaccctgacctaagaaggattctgacagactatggctttgaggga
catcctttccgaaaagactttcccctgtctggctacgttgagttacgctatgacgatgag
gtgaagcgggtggtggctgagccagtggagttggcccaggagttccgcaagtttgacctg
aacagcccatgggaggctttccctgcctatcgccagccccctgagagtcccaagcttgaa
gcaggagacaagaaacctgaaaccaagtag

DBGET integrated database retrieval system