Mustela putorius furo (domestic ferret): 101687256 Help Entry 101687256         CDS       T07239                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04015   Rap1 signaling pathway mpuf04810   Regulation of actin cytoskeleton mpuf05014   Amyotrophic lateral sclerosis mpuf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101687256 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101687256 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101687256 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101687256 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpuf04131]     101687256 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mpuf04812]     101687256 (PFN3)    04147 Exosome [BR:mpuf04147]     101687256 (PFN3) Membrane trafficking [BR:mpuf04131]  Others   Actin-binding proteins    Others     101687256 (PFN3) Cytoskeleton proteins [BR:mpuf04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101687256 (PFN3) Exosome [BR:mpuf04147]  Exosomal proteins   Proteins found in most exosomes    101687256 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101687256 NCBI-ProteinID:  XP_004737529 Ensembl:  ENSMPUG00000019313 UniProt:  M3Z6H3 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGHDRRTFL LSGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRVLLVLMGRRGVHGGI LNKTVHELIKGLRKQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggagactggaagggctatatcagtgcggtgttgcgtgaccagcgcattgacgacgtg gccatcgtgggtcactcagacaatcgctgcgtgtgggcatcgcgccccggaggccttctg gctgccatatcgccgcaggaggtgggtgtgctcacagggcatgaccggcgcaccttcctg ctgtcgggcctcagcgtggcgggccgccgctgctgcgtcatccgcgaccacttgctgtct gagggcgatggagttctggacgcgcgcaccaaggggctggatgggcgcgcggtctgcgtc ggccacaccccgcgcgtgctcctcgtgctcatgggcaggcgcggcgtgcacgggggcatc ctcaataagacggtgcatgaactgatcaagggtctgcgcaagcagggcacctag

DBGET integrated database retrieval system