Mustela putorius furo (domestic ferret): 101687379 Help Entry 101687379         CDS       T07239                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04060   Cytokine-cytokine receptor interaction mpuf04061   Viral protein interaction with cytokine and cytokine receptor mpuf04062   Chemokine signaling pathway mpuf04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101687379 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     101687379 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101687379 (CCL22)    04062 Chemokine signaling pathway     101687379 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpuf04052]     101687379 (CCL22) Cytokines and neuropeptides [BR:mpuf04052]  Cytokines   Chemokines    101687379 (CCL22) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  101687379 NCBI-ProteinID:  XP_004744299 Ensembl:  ENSMPUG00000004380 UniProt:  M3XZ46 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MASLNTPLLAALVFLALILQTTEAGPYGTNVEDSVCCREYFRHPLPLRMIRFFYWTSDSC RRPGVVFLTVKDREICADPRMPWVKKILQKLSA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgaacactccactcctggctgcccttgtctttcttgctctgatacttcaa acaactgaggcaggtccttatggcaccaacgtggaagacagcgtctgctgccgggagtac ttccgtcaccctctgcctctgcgcatgatcaggtttttctactggacttcagactcgtgc cggaggcctggcgtggtcttcctaactgtcaaggaccgggagatctgtgctgaccccaga atgccctgggtgaaaaagattctccagaaactgagcgcatga

DBGET integrated database retrieval system