Mustela putorius furo (domestic ferret): 101688037 Help Entry 101688037         CDS       T07239                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04060   Cytokine-cytokine receptor interaction mpuf04630   JAK-STAT signaling pathway mpuf04640   Hematopoietic cell lineage mpuf04657   IL-17 signaling pathway mpuf04658   Th1 and Th2 cell differentiation mpuf04660   T cell receptor signaling pathway mpuf04664   Fc epsilon RI signaling pathway mpuf04672   Intestinal immune network for IgA production mpuf05200   Pathways in cancer mpuf05310   Asthma mpuf05320   Autoimmune thyroid disease mpuf05321   Inflammatory bowel disease mpuf05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101688037 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101688037 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     101688037 (IL5)    04660 T cell receptor signaling pathway     101688037 (IL5)    04658 Th1 and Th2 cell differentiation     101688037 (IL5)    04657 IL-17 signaling pathway     101688037 (IL5)    04664 Fc epsilon RI signaling pathway     101688037 (IL5)    04672 Intestinal immune network for IgA production     101688037 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101688037 (IL5)   09163 Immune disease    05310 Asthma     101688037 (IL5)    05320 Autoimmune thyroid disease     101688037 (IL5)    05321 Inflammatory bowel disease     101688037 (IL5)    05330 Allograft rejection     101688037 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpuf04052]     101688037 (IL5)    00536 Glycosaminoglycan binding proteins [BR:mpuf00536]     101688037 (IL5) Cytokines and neuropeptides [BR:mpuf04052]  Cytokines   Interleukins    101688037 (IL5) Glycosaminoglycan binding proteins [BR:mpuf00536]  Heparan sulfate / Heparin   Cytokines    101688037 (IL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  101688037 NCBI-ProteinID:  XP_004745066 UniProt:  A0A8U0MJZ7 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MRLLLHLSLLALGAAYVSVTPVEDPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPENKNH QLCIEEVFQGIDILKNRTAQAAAVDKLFQNLSFIKAHIDSQKKKCGGERWRVKKFLDYLQ VFLGVINTEWTTES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagactgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgtcact cctgtagaagatcccatgaacagattggtggcagagaccttgacactgctctccactcat cgaactctgctgataggtgacgggaacctgatgattcctactcctgaaaataaaaatcac caactgtgcatcgaagaagtctttcagggtatagacatattaaagaaccgaactgcacaa gcagcggctgtggataaactattccaaaatttgtctttcataaaagcacatatagacagc caaaaaaaaaaatgtggaggagaaagatggagagtaaaaaagttcctagactacctgcaa gtgtttcttggtgtcataaacactgagtggacaacagaaagttga

DBGET integrated database retrieval system