KEGG   Mustela putorius furo (domestic ferret): 101689658
Entry
101689658         CDS       T07239                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X1
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
mpuf  Mustela putorius furo (domestic ferret)
Pathway
mpuf04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mpuf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101689658 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpuf04050]
    101689658 (TNFRSF8)
   04090 CD molecules [BR:mpuf04090]
    101689658 (TNFRSF8)
Cytokine receptors [BR:mpuf04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   101689658 (TNFRSF8)
CD molecules [BR:mpuf04090]
 Proteins
  101689658 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 101689658
NCBI-ProteinID: XP_004741510
Ensembl: ENSMPUG00000016383
LinkDB
Position
Unknown
AA seq 597 aa
MCPLHTMLGLLLLGVLGAFPQDGVRRNACEEGPNHSYDQTTGRCCYRCPEGHTSQQPCAR
GSSDCRKQCDPDYYLDRDGRCTACVTCSGDDLVEKIPCSANSSRVCECRPGMFCYTSATK
SCARCRPHSVCPPGEVVRFQGTAERDTICERPSPVTSPDRAATSSTLQARPLRTASASSR
ARTTLPGRGASLTLEHGSEITRAPSSPSSVREPGPGPGQISQQPCAQGSSDCGKQCDPDY
YLDRDGRCTACVTCSGDLVEKTPCTWNSSRVCECRSGMFCTTSATNSCARCTPRSSCPPG
TVTKPQGTAERGATHEPPPPEAHPDCSTNPEDSKTSTSASAPLVSSGDPQISKEHGRGIT
HAWGDTPISTSTPISFSSTGRPILVSGPVLFWMVVLLVVVLGSVSFLLCHRRACRKWIQQ
KLYPCYPVQTFRPKLEPADSRPGRNPTQLKSVSVVEPGTEELGLLSPPVAEASPGGAVCR
ESMRLLEASPPAGSPSSPRDLPEPPRVTSEHTNNRIEKIYIMKADTVIVGTVRTEVPEGR
GLVGPAGPEFEEDLEVDHAPRFPEQETEPPLDSCGDAMFSVEEEGKEASLPVTVTEK
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgtgccccctccacaccatgctgggactgctactcctgggggtgctgggagccttcccg
caggatggagttcggaggaacgcctgcgaggaaggccccaaccactcctatgaccagact
actgggaggtgctgttaccgctgccccgaggggcacacctcgcagcagccgtgcgcacgg
gggtcatccgactgcaggaagcagtgtgaccccgactactacctggacagggacggccgc
tgcacggcctgcgtgacctgttctggagacgatctcgtggagaagattccatgctcagcg
aattcctcccgcgtctgtgagtgtcggcctggcatgttctgttacacatcagccaccaaa
tcctgtgcccgctgtaggccgcactccgtctgcccaccaggggaggtcgtcaggttccag
ggcacagcagaaagggacaccatctgtgagcgaccttccccagtgaccagtcctgaccgg
gcggccaccagcagcaccctccaggccaggcccctcaggactgcctcagcaagctccagg
gcgaggaccacgcttcccggaaggggcgcttccctcaccctggaacacggttccgaaatt
acgagagcccccagctctccctcctcggtgcgggagcccggtccaggtccagggcagatc
tcccagcagccgtgcgcacaggggtcatcggactgcgggaagcagtgtgacccggactac
tacctagacagggacggccgctgcacggcctgcgtgacctgttctggagacctggtggag
aagacgccgtgcacatggaactcctctcgcgtctgcgaatgtcgatctggcatgttctgt
accacgtcagccaccaactcctgtgcccgctgtaccccccgctccagctgcccaccaggg
accgtcaccaaaccccagggtacagctgaaaggggtgccacccatgagccacctccccct
gaggcccaccctgattgcagcaccaacccagaggacagcaagacgtccaccagtgcctct
gcccctctggtctcctcgggagacccccagatcagtaaggagcatggaaggggcatcacc
cacgcttggggagacacccccatatcaacgagcactcccatctctttctcctccacggga
aggcccattctggtttcagggcccgtgctcttctggatggtcgtgctactggtggtggtc
ttgggctccgtgtccttcctcctgtgccaccggagggcctgccggaagtggattcagcag
aagctctacccgtgctaccctgtccagaccttccggcccaagctggagcctgcagattcc
aggcctgggaggaacccgacacagctgaagagtgtgtcagtggtggagccgggcacggaa
gagctgggcttgctgagccccccggttgcggaggcctcccccggcggggcagtctgccga
gagagcatgcggctgctggaagccagccctcccgccgggagcccctcgtcccccagggac
ctccccgagcccccccgggtgacctcggagcataccaacaacaggatcgagaagatctac
atcatgaaggctgacacagtgattgtggggactgtgaggactgaggtgcccgagggccgg
gggctggtggggccggcggggcctgagttcgaggaggatctggaagtggaccacgccccc
cgcttcccagagcaggagacagagccgcctctggacagctgtggggacgccatgttctcg
gtggaagaggaaggaaaggaggcctccttgcccgtgaccgtcacggagaaatga

DBGET integrated database retrieval system