Mustela putorius furo (domestic ferret): 101691517 Help Entry 101691517         CDS       T07239                                  Symbol UBL5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism mpuf  Mustela putorius furo (domestic ferret) Brite KEGG Orthology (KO) [BR:mpuf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:mpuf03041]     101691517 (UBL5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpuf04052]     101691517 (UBL5) Spliceosome [BR:mpuf03041]  Complex B   Other components    Complex B specific factors     101691517 (UBL5) Cytokines and neuropeptides [BR:mpuf04052]  Neuropeptides   Unclassified    101691517 (UBL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  101691517 NCBI-ProteinID:  XP_004782051 UniProt:  A0A8U0T8C0 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccgtctagggaagaaggtccgcgttaagtgcaacact gatgacaccatcggggaccttaagaagctgatcgcagcccaaactggcacccgttggaac aagatcgtcctgaagaagtggtacacgatttttaaggaccacgtgtctctgggggactat gaaatccacgatgggatgaacctggagctttattaccagtag

DBGET integrated database retrieval system