Mustela putorius furo (domestic ferret): 101691655 Help Entry 101691655         CDS       T07239                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04621   NOD-like receptor signaling pathway mpuf05012   Parkinson disease mpuf05132   Salmonella infection mpuf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101691655 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101691655 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     101691655 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101691655 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mpuf03110]     101691655 (TXN) Chaperones and folding catalysts [BR:mpuf03110]  Protein folding catalysts   Protein disulfide isomerase    101691655 (TXN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_7 Glutaredoxin Thioredoxin_9 Redoxin Motif Other DBs NCBI-GeneID:  101691655 NCBI-ProteinID:  XP_004747837 Ensembl:  ENSMPUG00000007426 UniProt:  M3Y7R3 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKQIESKIAFQEALVGAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaagattgcttttcaggaagccttggttggtgcaggggat aaacttgtagtagttgacttctcagccacgtggtgtgggccttgcaaaatgatcaagcct ttctttcattccctctctgagaagtattccaatgtggtgttccttgaagtagacgtggat gactgtcaggacgtcgcttcagagtgtgaagtcaaatgcatgccgaccttccagtttttt aaaaagggacagaaggtgggtgaattttctggagctaataaggaaaaacttgaagccacc ataaatgaattaatctaa

DBGET integrated database retrieval system