Mustela putorius furo (domestic ferret): 101693436 Help Entry 101693436         CDS       T07239                                  Name (RefSeq) histone H2AX   KO K11251   histone H2A Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf03082   ATP-dependent chromatin remodeling mpuf04217   Necroptosis mpuf04613   Neutrophil extracellular trap formation mpuf05034   Alcoholism mpuf05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mpuf00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101693436  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101693436  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101693436  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     101693436   09165 Substance dependence    05034 Alcoholism     101693436  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpuf03036]     101693436   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpuf04147]     101693436 Chromosome and associated proteins [BR:mpuf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101693436 Exosome [BR:mpuf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101693436 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  101693436 NCBI-ProteinID:  XP_004750077 UniProt:  A0A8U0SUG2 LinkDB All DBs Position Unknown AA seq 143 aa AA seqDB search MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TSATVGPKAPAGGKKATQASQEY NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgtcgggccgcggcaagaccggcggcaaggcccgcgccaaggccaagtcgcgctcgtcg cgcgccggcctccagttcccagtgggccgcgtgcaccggctgctgcggaagggccactac gccgagcgggtcggcgccggcgcgccggtgtacctggcggcggtgctcgagtacctcacc gcggagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcggatcatc ccccgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcggc gtgacgatcgcccagggaggcgtcctgcctaacatccaggccgtgctgctgcccaagaag accagcgccaccgtggggccgaaggcgcccgcggggggcaagaaggccacccaggcctct caggagtactga

DBGET integrated database retrieval system