Mustela putorius furo (domestic ferret): 101693829 Help Entry 101693829         CDS       T07239                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04024   cAMP signaling pathway mpuf04062   Chemokine signaling pathway mpuf04064   NF-kappa B signaling pathway mpuf04210   Apoptosis mpuf04380   Osteoclast differentiation mpuf04620   Toll-like receptor signaling pathway mpuf04621   NOD-like receptor signaling pathway mpuf04622   RIG-I-like receptor signaling pathway mpuf04623   Cytosolic DNA-sensing pathway mpuf04625   C-type lectin receptor signaling pathway mpuf04657   IL-17 signaling pathway mpuf04658   Th1 and Th2 cell differentiation mpuf04659   Th17 cell differentiation mpuf04660   T cell receptor signaling pathway mpuf04662   B cell receptor signaling pathway mpuf04668   TNF signaling pathway mpuf04722   Neurotrophin signaling pathway mpuf04920   Adipocytokine signaling pathway mpuf04926   Relaxin signaling pathway mpuf04931   Insulin resistance mpuf04936   Alcoholic liver disease mpuf05132   Salmonella infection mpuf05134   Legionellosis mpuf05135   Yersinia infection mpuf05140   Leishmaniasis mpuf05142   Chagas disease mpuf05145   Toxoplasmosis mpuf05160   Hepatitis C mpuf05161   Hepatitis B mpuf05162   Measles mpuf05163   Human cytomegalovirus infection mpuf05164   Influenza A mpuf05166   Human T-cell leukemia virus 1 infection mpuf05167   Kaposi sarcoma-associated herpesvirus infection mpuf05168   Herpes simplex virus 1 infection mpuf05169   Epstein-Barr virus infection mpuf05170   Human immunodeficiency virus 1 infection mpuf05171   Coronavirus disease - COVID-19 mpuf05200   Pathways in cancer mpuf05203   Viral carcinogenesis mpuf05208   Chemical carcinogenesis - reactive oxygen species mpuf05215   Prostate cancer mpuf05220   Chronic myeloid leukemia mpuf05222   Small cell lung cancer mpuf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mpuf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     101693829 (NFKBIA)    04668 TNF signaling pathway     101693829 (NFKBIA)    04024 cAMP signaling pathway     101693829 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     101693829 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101693829 (NFKBIA)    04621 NOD-like receptor signaling pathway     101693829 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     101693829 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     101693829 (NFKBIA)    04625 C-type lectin receptor signaling pathway     101693829 (NFKBIA)    04660 T cell receptor signaling pathway     101693829 (NFKBIA)    04658 Th1 and Th2 cell differentiation     101693829 (NFKBIA)    04659 Th17 cell differentiation     101693829 (NFKBIA)    04657 IL-17 signaling pathway     101693829 (NFKBIA)    04662 B cell receptor signaling pathway     101693829 (NFKBIA)    04062 Chemokine signaling pathway     101693829 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     101693829 (NFKBIA)    04926 Relaxin signaling pathway     101693829 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     101693829 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     101693829 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101693829 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     101693829 (NFKBIA)    05203 Viral carcinogenesis     101693829 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101693829 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     101693829 (NFKBIA)    05215 Prostate cancer     101693829 (NFKBIA)    05222 Small cell lung cancer     101693829 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101693829 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     101693829 (NFKBIA)    05161 Hepatitis B     101693829 (NFKBIA)    05160 Hepatitis C     101693829 (NFKBIA)    05171 Coronavirus disease - COVID-19     101693829 (NFKBIA)    05164 Influenza A     101693829 (NFKBIA)    05162 Measles     101693829 (NFKBIA)    05168 Herpes simplex virus 1 infection     101693829 (NFKBIA)    05163 Human cytomegalovirus infection     101693829 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     101693829 (NFKBIA)    05169 Epstein-Barr virus infection     101693829 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     101693829 (NFKBIA)    05135 Yersinia infection     101693829 (NFKBIA)    05134 Legionellosis     101693829 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101693829 (NFKBIA)    05140 Leishmaniasis     101693829 (NFKBIA)    05142 Chagas disease     101693829 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101693829 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101693829 (NFKBIA)    04931 Insulin resistance     101693829 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mpuf03000]     101693829 (NFKBIA)    04131 Membrane trafficking [BR:mpuf04131]     101693829 (NFKBIA) Transcription factors [BR:mpuf03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     101693829 (NFKBIA) Membrane trafficking [BR:mpuf04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     101693829 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  101693829 NCBI-ProteinID:  XP_004773395 Ensembl:  ENSMPUG00000016286 UniProt:  M3YXX3 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFQAAEHNQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQLVKELKEIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLSSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcaggccgccgagcacaaccaggactgggccatggagggtccccgggacgcgctc aagaaggagcgcctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagttggtgaaggaactgaaggagatccgcctcgagccgcaggaggcgccg cgcggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcactgaccatggaagtgatccgccaagtgaagggcgac ctggcctttctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccaaccagaaattgctgaggcacttctgggagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcaaggctgcctggccagtgtg ggagtcctgactcagacctgcaggacccagcacctctcctccatcctccaggccactaac tacaatgggcacacatgtctccatttagcctctatccatggttacttgggcattgtggaa cttctggtgtctctgggtgctgacgtcaatgctcaggagccctgcaatggccgaaccgcc ctccatctcgccgtggacctccagaattctgatctcgtgtcactcttgttgaagtgtggg gctgatgtcaacagagttacctaccagggctattccccataccagctcacctggggccgc ccaagcacgcggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg ccagagagcgaggatgaggagagctacgacacagagtccgagttcacggaggacgagctg ccctatgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system