Methanolobus psychrophilus: Mpsy_0975 Help Entry Mpsy_0975         CDS       T02280                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mpy  Methanolobus psychrophilus Pathway mpy03010   Ribosome Brite KEGG Orthology (KO) [BR:mpy00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Mpsy_0975   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Mpsy_0975  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mpy03011]     Mpsy_0975    04121 Ubiquitin system [BR:mpy04121]     Mpsy_0975   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpy04147]     Mpsy_0975 Ribosome [BR:mpy03011]  Ribosomal proteins   Eukaryotes    Small subunit     Mpsy_0975   Archaea     Mpsy_0975 Ubiquitin system [BR:mpy04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Mpsy_0975 Exosome [BR:mpy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Mpsy_0975   Exosomal proteins of colorectal cancer cells    Mpsy_0975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e DUF1451 DUF5795 Zn_ribbon_IS1595 Zn_ribbon_NUD DZR_2 Lar_restr_allev MqsA_antitoxin Motif Other DBs NCBI-ProteinID:  AFV23184 LinkDB All DBs Position 967223..967372 Genome browser AA seq 49 aa AA seqDB search MAAKDYYKVNGDSIERANQICPRCGEGVFLAEHKDRRSCGKCAYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggctgcaaaagattactacaaggtcaatggtgattccattgagagggcaaaccagatc tgcccccgctgtggagaaggcgtattcctggctgagcacaaggacagacgctcctgcgga aagtgcgcatacactgagttcaagaaataa

DBGET integrated database retrieval system