Methanolobus psychrophilus: Mpsy_1209 Help Entry Mpsy_1209         CDS       T02280                                  Name (GenBank) histone   KO K24450   DNA-binding protein Organism mpy  Methanolobus psychrophilus Brite KEGG Orthology (KO) [BR:mpy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpy03036]     Mpsy_1209 Chromosome and associated proteins [BR:mpy03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     Mpsy_1209 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone Bromo_TP TFIID-31kDa CENP-S CENP-T_C TAF TFIID-18kDa Peptidase_C39 LonB_AAA-LID Motif Other DBs NCBI-ProteinID:  AFV23417 LinkDB All DBs Position 1209089..1209301 Genome browser AA seq 70 aa AA seqDB search MTIIPFAPIERVIRNAGAQRVSESAAMALTEMLESYGLEVSREAIKLAEHAGRKTVKAED IKLAREMLGK NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgacaataataccatttgcacccattgaaagagtaataaggaacgctggcgcacagaga gtcagtgaatcagcagcaatggcccttactgaaatgcttgagtcttacgggttagaggtt tccagggaagccataaaactggcagagcacgcaggaaggaagacagtcaaggctgaagat attaagctggcccgggaaatgctgggcaaataa

DBGET integrated database retrieval system