Mumia qirimensis: AB3M34_06450 Help Entry AB3M34_06450      CDS       T10923                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism mqr  Mumia qirimensis Brite KEGG Orthology (KO) [BR:mqr00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     AB3M34_06450 Enzymes [BR:mqr01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      AB3M34_06450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Thioredoxin GST_N_3 Glrx-like GST_N_2 DUF3088 Motif Other DBs NCBI-ProteinID:  XEK81259 LinkDB All DBs Position complement(1347144..1347395) Genome browser AA seq 83 aa AA seqDB search MSATFTMYSTPWCGYCKRLKSQLDREGIAFAEVDIEQDEDAAFVVERANGGNQTVPTLVF ADGSALTNPSVAQVKAQLAALNV NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtcggccacgttcacgatgtactcgacaccttggtgtggatactgcaagcgcctcaag agtcagctcgaccgtgagggcatcgcgttcgccgaggtcgacatcgagcaggacgaggac gccgcgttcgtcgtcgagcgcgccaacggtggcaaccagaccgtgccgacgctcgtcttc gcggacggctccgcgctgacgaacccgtcggtcgctcaggtcaaggcccagctcgccgcg ctcaacgtctga

DBGET integrated database retrieval system