Meiothermus ruber DSM 1279: Mrub_2203
Help
Entry
Mrub_2203 CDS
T01193
Name
(GenBank) phosphonate ABC transporter, ATPase subunit
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
mrb
Meiothermus ruber DSM 1279
Pathway
mrb02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
mrb00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
Mrub_2203
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
mrb02000
]
Mrub_2203
Enzymes [BR:
mrb01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
Mrub_2203
Transporters [BR:
mrb02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
Mrub_2203
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
SMC_N
AAA_29
AAA_22
MMR_HSR1
RsgA_GTPase
Dynamin_N
FtsK_SpoIIIE
AAA_16
nSTAND1
IIGP
PRK
DUF87
NACHT
AAA_30
AAA_10
AAA_27
AAA_24
Motif
Other DBs
NCBI-ProteinID:
ADD28956
UniProt:
D3PKT2
LinkDB
All DBs
Position
complement(2255639..2256397)
Genome browser
AA seq
252 aa
AA seq
DB search
MIEVRNLNQTFQTAKGPLQVLMDVNLEIAPGDFVAVIGRSGAGKSTFLRTLNGLLIPTSG
SVIVNGTDITKLPKRELQKYRRTVGFIFQQFNLVNRLSALENVLHGRLGYLPTWRGLLGL
YSEADYQIARQQLERVDLAAKENARVDSLSGGQQQRVAIARAMAQQPTLMLADEPAANLD
PVLSEEVMRTLKRFNEQDGVTVVINIHALDLALKYAKRIVAFKRGRLVFDGAPAQLTESI
IDDLYERKEMLA
NT seq
759 nt
NT seq
+upstream
nt +downstream
nt
atgattgaagtccgaaaccttaaccagacctttcaaaccgccaaggggccccttcaggtt
ctgatggacgtgaacctcgagattgcccctggggattttgtggccgtaattgggcgctcg
ggggccggtaagagcacctttttgcgcaccctcaatgggctgctgattcccacctcgggc
tcggtgattgtcaatggtaccgatattaccaagctgcccaagcgcgagttgcagaagtac
cgccgcacggtcggcttcattttccagcagttcaacctggtcaaccgcctgagtgctctg
gaaaacgtgttgcatggccggctgggctatctgcccacctggcgcggcctgctgggtctg
tacagcgaggccgactaccagattgcccgccagcagctcgagcgcgtagacctggccgca
aaagagaacgctcgagtggactcgctctcgggtgggcagcagcaacgggtggccatcgcc
cgggccatggcccagcagcccaccctgatgctggccgacgagccggcggccaacctcgac
ccggtgctctcggaggaggtgatgcgcaccctcaagcgcttcaacgagcaggacggggtc
acagtggtgatcaacatccacgccctcgacctggccctgaagtacgccaagcgcatcgtg
gctttcaagcgcgggcggctggtgttcgatggggcgccggcacagcttaccgagtcgatc
atcgacgatctatacgagcgcaaggagatgctggcatga
DBGET
integrated database retrieval system