Methanoculleus receptaculi: R6Y96_09915 Help Entry R6Y96_09915       CDS       T09536                                  Name (GenBank) histone family protein   KO K24450   DNA-binding protein Organism mrc  Methanoculleus receptaculi Brite KEGG Orthology (KO) [BR:mrc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mrc03036]     R6Y96_09915 Chromosome and associated proteins [BR:mrc03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     R6Y96_09915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C Bromo_TP TFIID-31kDa TAF CENP-S TFIID_20kDa HK97-gp10_like Motif Other DBs NCBI-ProteinID:  WOX57591 LinkDB All DBs Position 1893161..1893370 Genome browser AA seq 69 aa AA seqDB search MTEIPLAPVGRLIKKAGAERVSSDASEELARLMEDYAARVAKEAIKLAGHAGRKTVKAID IRMATETLK NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgactgaaatacctcttgcacctgttggaaggctcataaagaaagccggtgcagaacgg gtgagttctgatgccagcgaggaactcgcaagactgatggaagattatgctgcgcgggtc gcaaaagaggcgatcaaactggcgggtcatgcaggcaggaagacggtcaaggcaatcgat atccggatggcgaccgagactctgaagtga

DBGET integrated database retrieval system