Meiothermus ruber DSM 1279: K649_02965 Help Entry K649_02965        CDS       T02636                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mre  Meiothermus ruber DSM 1279 Pathway mre01100   Metabolic pathways mre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mre00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K649_02965    00074 Mycolic acid biosynthesis     K649_02965   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K649_02965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  AGK03895 UniProt:  D3PNN9 LinkDB All DBs Position complement(577213..577446) Genome browser AA seq 77 aa AA seqDB search MAILDDVREVIVEKLGVDAEKVVPEARFIEDLGADSLDTVELIMGLEDKFGLEISDEDAE KIRTVQDAIDFIQSKQA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcaatcctagacgatgtaagagaagtgatcgtggaaaaactcggcgtggatgccgaa aaagtagtgcccgaggcccgctttatcgaagatctgggcgctgacagcctcgataccgta gagctgatcatgggcctggaggacaagttcggcctggagatctccgacgaagacgcagaa aaaatccgcaccgtacaggacgccatcgatttcatccaaagcaagcaagcttag

DBGET integrated database retrieval system