Muntiacus reevesi (Reeves' muntjac): 136143869 Help Entry 136143869         CDS       T10466                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism mree  Muntiacus reevesi (Reeves' muntjac) Brite KEGG Orthology (KO) [BR:mree00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:mree01002]     136143869   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mree04147]     136143869 Peptidases and inhibitors [BR:mree01002]  Peptidase inhibitors   Family I25: cystatin family    136143869 Exosome [BR:mree04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    136143869 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin 5-FTHF_cyc-lig Motif Other DBs NCBI-GeneID:  136143869 NCBI-ProteinID:  XP_065757629 LinkDB All DBs Position 10:17223654..17223935 Genome browser AA seq 93 aa AA seqDB search MTRGAPPAKQLAVAEIQAIADKVKFPLEEKFLVFNAVEFKSQGVAGRTFFIKVQMDDDFV HIQMFESLLQENKSVALTSYQTHKGRQDEVMCF NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgacgcgtggtgcgccccctgccaagcagctggccgtggctgagatccaagccattgct gacaaggtgaagttcccgctggaagagaagttcctggtgttcaatgctgtggagttcaaa agccaaggagttgctgggaggaccttcttcatcaaggttcagatggatgatgactttgtg cacattcaaatgtttgaaagccttctacaggagaacaagtcagtggccttgaccagctac cagacccacaaaggcagacaagacgaagtgatgtgcttctag

DBGET integrated database retrieval system