Muntiacus reevesi (Reeves' muntjac): 136145676 Help Entry 136145676         CDS       T10466                                  Name (RefSeq) calmodulin-1-like   KO K02183   calmodulin Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04014   Ras signaling pathway mree04015   Rap1 signaling pathway mree04020   Calcium signaling pathway mree04022   cGMP-PKG signaling pathway mree04024   cAMP signaling pathway mree04070   Phosphatidylinositol signaling system mree04114   Oocyte meiosis mree04218   Cellular senescence mree04261   Adrenergic signaling in cardiomyocytes mree04270   Vascular smooth muscle contraction mree04371   Apelin signaling pathway mree04625   C-type lectin receptor signaling pathway mree04713   Circadian entrainment mree04720   Long-term potentiation mree04722   Neurotrophin signaling pathway mree04728   Dopaminergic synapse mree04740   Olfactory transduction mree04744   Phototransduction mree04750   Inflammatory mediator regulation of TRP channels mree04910   Insulin signaling pathway mree04912   GnRH signaling pathway mree04915   Estrogen signaling pathway mree04916   Melanogenesis mree04921   Oxytocin signaling pathway mree04922   Glucagon signaling pathway mree04924   Renin secretion mree04925   Aldosterone synthesis and secretion mree04970   Salivary secretion mree04971   Gastric acid secretion mree05010   Alzheimer disease mree05012   Parkinson disease mree05022   Pathways of neurodegeneration - multiple diseases mree05031   Amphetamine addiction mree05034   Alcoholism mree05133   Pertussis mree05152   Tuberculosis mree05163   Human cytomegalovirus infection mree05167   Kaposi sarcoma-associated herpesvirus infection mree05170   Human immunodeficiency virus 1 infection mree05200   Pathways in cancer mree05214   Glioma mree05417   Lipid and atherosclerosis mree05418   Fluid shear stress and atherosclerosis Brite Protein phosphatases and associated proteins [BR:mree01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      136145676 Membrane trafficking [BR:mree04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     136145676 Chromosome and associated proteins [BR:mree03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      136145676 Exosome [BR:mree04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    136145676 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  136145676 NCBI-ProteinID:  XP_065760292 LinkDB All DBs Position 13:37141992..37143044 Genome browser AA seq 113 aa AA seqDB search MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKVKDTDSEEEIREAFHVFDKD GNGYISAAELCHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgaggtctcttgggcagaatcccacagaagcagagttacaggacatgattaatgaagta gatgctgatggtaatggcacaattgacttcccggaatttctgacaatgatggcaagaaaa gtgaaagacacagacagtgaagaagaaattagagaagcattccatgtgtttgataaggat ggtaatggctatattagtgcagcagagctctgccatgtgatgacaaaccttggagagaag ttaacagatgaagaggttgatgaaatgatcagagaagcagatattgatggtgatggtcaa gtaaactatgaagagtttgtacaaatgatgacagcaaaatga

DBGET integrated database retrieval system