KEGG   Muntiacus reevesi (Reeves' muntjac): 136145840
Entry
136145840         CDS       T10466                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mree  Muntiacus reevesi (Reeves' muntjac)
Pathway
mree01521  EGFR tyrosine kinase inhibitor resistance
mree01522  Endocrine resistance
mree01524  Platinum drug resistance
mree04010  MAPK signaling pathway
mree04012  ErbB signaling pathway
mree04014  Ras signaling pathway
mree04015  Rap1 signaling pathway
mree04022  cGMP-PKG signaling pathway
mree04024  cAMP signaling pathway
mree04062  Chemokine signaling pathway
mree04066  HIF-1 signaling pathway
mree04068  FoxO signaling pathway
mree04071  Sphingolipid signaling pathway
mree04072  Phospholipase D signaling pathway
mree04114  Oocyte meiosis
mree04140  Autophagy - animal
mree04148  Efferocytosis
mree04150  mTOR signaling pathway
mree04151  PI3K-Akt signaling pathway
mree04210  Apoptosis
mree04218  Cellular senescence
mree04261  Adrenergic signaling in cardiomyocytes
mree04270  Vascular smooth muscle contraction
mree04350  TGF-beta signaling pathway
mree04360  Axon guidance
mree04370  VEGF signaling pathway
mree04371  Apelin signaling pathway
mree04380  Osteoclast differentiation
mree04510  Focal adhesion
mree04517  IgSF CAM signaling
mree04520  Adherens junction
mree04540  Gap junction
mree04550  Signaling pathways regulating pluripotency of stem cells
mree04611  Platelet activation
mree04613  Neutrophil extracellular trap formation
mree04620  Toll-like receptor signaling pathway
mree04621  NOD-like receptor signaling pathway
mree04625  C-type lectin receptor signaling pathway
mree04650  Natural killer cell mediated cytotoxicity
mree04657  IL-17 signaling pathway
mree04658  Th1 and Th2 cell differentiation
mree04659  Th17 cell differentiation
mree04660  T cell receptor signaling pathway
mree04662  B cell receptor signaling pathway
mree04664  Fc epsilon RI signaling pathway
mree04666  Fc gamma R-mediated phagocytosis
mree04668  TNF signaling pathway
mree04713  Circadian entrainment
mree04720  Long-term potentiation
mree04722  Neurotrophin signaling pathway
mree04723  Retrograde endocannabinoid signaling
mree04724  Glutamatergic synapse
mree04725  Cholinergic synapse
mree04726  Serotonergic synapse
mree04730  Long-term depression
mree04810  Regulation of actin cytoskeleton
mree04910  Insulin signaling pathway
mree04912  GnRH signaling pathway
mree04914  Progesterone-mediated oocyte maturation
mree04915  Estrogen signaling pathway
mree04916  Melanogenesis
mree04917  Prolactin signaling pathway
mree04919  Thyroid hormone signaling pathway
mree04921  Oxytocin signaling pathway
mree04926  Relaxin signaling pathway
mree04928  Parathyroid hormone synthesis, secretion and action
mree04929  GnRH secretion
mree04930  Type II diabetes mellitus
mree04933  AGE-RAGE signaling pathway in diabetic complications
mree04934  Cushing syndrome
mree04935  Growth hormone synthesis, secretion and action
mree04960  Aldosterone-regulated sodium reabsorption
mree05010  Alzheimer disease
mree05020  Prion disease
mree05022  Pathways of neurodegeneration - multiple diseases
mree05034  Alcoholism
mree05132  Salmonella infection
mree05133  Pertussis
mree05135  Yersinia infection
mree05140  Leishmaniasis
mree05142  Chagas disease
mree05145  Toxoplasmosis
mree05152  Tuberculosis
mree05160  Hepatitis C
mree05161  Hepatitis B
mree05163  Human cytomegalovirus infection
mree05164  Influenza A
mree05165  Human papillomavirus infection
mree05166  Human T-cell leukemia virus 1 infection
mree05167  Kaposi sarcoma-associated herpesvirus infection
mree05170  Human immunodeficiency virus 1 infection
mree05171  Coronavirus disease - COVID-19
mree05200  Pathways in cancer
mree05203  Viral carcinogenesis
mree05205  Proteoglycans in cancer
mree05206  MicroRNAs in cancer
mree05207  Chemical carcinogenesis - receptor activation
mree05208  Chemical carcinogenesis - reactive oxygen species
mree05210  Colorectal cancer
mree05211  Renal cell carcinoma
mree05212  Pancreatic cancer
mree05213  Endometrial cancer
mree05214  Glioma
mree05215  Prostate cancer
mree05216  Thyroid cancer
mree05218  Melanoma
mree05219  Bladder cancer
mree05220  Chronic myeloid leukemia
mree05221  Acute myeloid leukemia
mree05223  Non-small cell lung cancer
mree05224  Breast cancer
mree05225  Hepatocellular carcinoma
mree05226  Gastric cancer
mree05230  Central carbon metabolism in cancer
mree05231  Choline metabolism in cancer
mree05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mree05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mree00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    136145840 (MAPK1)
   04012 ErbB signaling pathway
    136145840 (MAPK1)
   04014 Ras signaling pathway
    136145840 (MAPK1)
   04015 Rap1 signaling pathway
    136145840 (MAPK1)
   04350 TGF-beta signaling pathway
    136145840 (MAPK1)
   04370 VEGF signaling pathway
    136145840 (MAPK1)
   04371 Apelin signaling pathway
    136145840 (MAPK1)
   04668 TNF signaling pathway
    136145840 (MAPK1)
   04066 HIF-1 signaling pathway
    136145840 (MAPK1)
   04068 FoxO signaling pathway
    136145840 (MAPK1)
   04072 Phospholipase D signaling pathway
    136145840 (MAPK1)
   04071 Sphingolipid signaling pathway
    136145840 (MAPK1)
   04024 cAMP signaling pathway
    136145840 (MAPK1)
   04022 cGMP-PKG signaling pathway
    136145840 (MAPK1)
   04151 PI3K-Akt signaling pathway
    136145840 (MAPK1)
   04150 mTOR signaling pathway
    136145840 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    136145840 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    136145840 (MAPK1)
   04148 Efferocytosis
    136145840 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    136145840 (MAPK1)
   04210 Apoptosis
    136145840 (MAPK1)
   04218 Cellular senescence
    136145840 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    136145840 (MAPK1)
   04520 Adherens junction
    136145840 (MAPK1)
   04540 Gap junction
    136145840 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    136145840 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    136145840 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    136145840 (MAPK1)
   04613 Neutrophil extracellular trap formation
    136145840 (MAPK1)
   04620 Toll-like receptor signaling pathway
    136145840 (MAPK1)
   04621 NOD-like receptor signaling pathway
    136145840 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    136145840 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    136145840 (MAPK1)
   04660 T cell receptor signaling pathway
    136145840 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    136145840 (MAPK1)
   04659 Th17 cell differentiation
    136145840 (MAPK1)
   04657 IL-17 signaling pathway
    136145840 (MAPK1)
   04662 B cell receptor signaling pathway
    136145840 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    136145840 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    136145840 (MAPK1)
   04062 Chemokine signaling pathway
    136145840 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    136145840 (MAPK1)
   04929 GnRH secretion
    136145840 (MAPK1)
   04912 GnRH signaling pathway
    136145840 (MAPK1)
   04915 Estrogen signaling pathway
    136145840 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    136145840 (MAPK1)
   04917 Prolactin signaling pathway
    136145840 (MAPK1)
   04921 Oxytocin signaling pathway
    136145840 (MAPK1)
   04926 Relaxin signaling pathway
    136145840 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    136145840 (MAPK1)
   04919 Thyroid hormone signaling pathway
    136145840 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    136145840 (MAPK1)
   04916 Melanogenesis
    136145840 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    136145840 (MAPK1)
   04270 Vascular smooth muscle contraction
    136145840 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    136145840 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    136145840 (MAPK1)
   04725 Cholinergic synapse
    136145840 (MAPK1)
   04726 Serotonergic synapse
    136145840 (MAPK1)
   04720 Long-term potentiation
    136145840 (MAPK1)
   04730 Long-term depression
    136145840 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    136145840 (MAPK1)
   04722 Neurotrophin signaling pathway
    136145840 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    136145840 (MAPK1)
   04380 Osteoclast differentiation
    136145840 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    136145840 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    136145840 (MAPK1)
   05206 MicroRNAs in cancer
    136145840 (MAPK1)
   05205 Proteoglycans in cancer
    136145840 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    136145840 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    136145840 (MAPK1)
   05203 Viral carcinogenesis
    136145840 (MAPK1)
   05230 Central carbon metabolism in cancer
    136145840 (MAPK1)
   05231 Choline metabolism in cancer
    136145840 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    136145840 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    136145840 (MAPK1)
   05212 Pancreatic cancer
    136145840 (MAPK1)
   05225 Hepatocellular carcinoma
    136145840 (MAPK1)
   05226 Gastric cancer
    136145840 (MAPK1)
   05214 Glioma
    136145840 (MAPK1)
   05216 Thyroid cancer
    136145840 (MAPK1)
   05221 Acute myeloid leukemia
    136145840 (MAPK1)
   05220 Chronic myeloid leukemia
    136145840 (MAPK1)
   05218 Melanoma
    136145840 (MAPK1)
   05211 Renal cell carcinoma
    136145840 (MAPK1)
   05219 Bladder cancer
    136145840 (MAPK1)
   05215 Prostate cancer
    136145840 (MAPK1)
   05213 Endometrial cancer
    136145840 (MAPK1)
   05224 Breast cancer
    136145840 (MAPK1)
   05223 Non-small cell lung cancer
    136145840 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    136145840 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    136145840 (MAPK1)
   05161 Hepatitis B
    136145840 (MAPK1)
   05160 Hepatitis C
    136145840 (MAPK1)
   05171 Coronavirus disease - COVID-19
    136145840 (MAPK1)
   05164 Influenza A
    136145840 (MAPK1)
   05163 Human cytomegalovirus infection
    136145840 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    136145840 (MAPK1)
   05165 Human papillomavirus infection
    136145840 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    136145840 (MAPK1)
   05135 Yersinia infection
    136145840 (MAPK1)
   05133 Pertussis
    136145840 (MAPK1)
   05152 Tuberculosis
    136145840 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    136145840 (MAPK1)
   05140 Leishmaniasis
    136145840 (MAPK1)
   05142 Chagas disease
    136145840 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    136145840 (MAPK1)
   05020 Prion disease
    136145840 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    136145840 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    136145840 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    136145840 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    136145840 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    136145840 (MAPK1)
   04934 Cushing syndrome
    136145840 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    136145840 (MAPK1)
   01524 Platinum drug resistance
    136145840 (MAPK1)
   01522 Endocrine resistance
    136145840 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mree01001]
    136145840 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mree03036]
    136145840 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mree04147]
    136145840 (MAPK1)
Enzymes [BR:mree01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     136145840 (MAPK1)
Protein kinases [BR:mree01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   136145840 (MAPK1)
Chromosome and associated proteins [BR:mree03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     136145840 (MAPK1)
Exosome [BR:mree04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   136145840 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 136145840
NCBI-ProteinID: XP_065760600
LinkDB
Position
13:complement(1112370..1168887)
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaatctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagtccttttgag
caccaaacctactgccagagaacgctgagagagataaaaatcctcctgcgcttccgacac
gagaacatcattggaatcaatgacatcattcgagcgccgaccatcgagcagatgaaagat
gtgtacatagtacaggacctcatggaaacagatctctacaagctcttgaagacgcaacac
ctcagcaatgaccatatctgctacttcctttaccagatcctcagagggttaaagtatatc
cattcagccaacgtgctgcaccgtgacctcaaaccttccaacctgctgctcaacaccacc
tgcgatctcaagatctgtgactttggcttggcccgtgttgcagatccggaccacgaccac
acagggttcctgacagagtacgtggccactcgctggtaccgggctccagaaatcatgttg
aattccaagggctacaccaagtccatcgacatctggtccgtgggctgcatcctagccgag
atgctctccaacaggcccatcttccctgggaagcattaccttgaccagctgaaccacatt
ctgggtattcttggatccccatcgcaggaagacctgaattgtataataaatttaaaagct
agaaactatctgctctctcttccacacaaaaataaggtgccatggaacaggctgttcccg
aacgctgactccaaagctctggatttactggacaaaatgttgacattcaaccctcacaag
aggatcgaggtggagcaggccttggctcacccgtacctggagcagtactacgacccgagc
gacgagcctgtcgccgaagcacccttcaagtttgacatggaattggacgacttgcctaag
gaaaagctcaaagagctcatttttgaagagactgctcgattccagccgggataccgatct
taa

DBGET integrated database retrieval system