Muntiacus reevesi (Reeves' muntjac): 136146879 Help Entry 136146879         CDS       T10466                                  Symbol CFL2 Name (RefSeq) cofilin-2   KO K05765   cofilin Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04360   Axon guidance mree04666   Fc gamma R-mediated phagocytosis mree04810   Regulation of actin cytoskeleton mree05133   Pertussis mree05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:mree00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     136146879 (CFL2)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     136146879 (CFL2)   09158 Development and regeneration    04360 Axon guidance     136146879 (CFL2)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     136146879 (CFL2)   09171 Infectious disease: bacterial    05133 Pertussis     136146879 (CFL2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mree04131]     136146879 (CFL2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mree04812]     136146879 (CFL2)    04147 Exosome [BR:mree04147]     136146879 (CFL2) Membrane trafficking [BR:mree04131]  Others   Actin-binding proteins    Others     136146879 (CFL2) Cytoskeleton proteins [BR:mree04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      136146879 (CFL2) Exosome [BR:mree04147]  Exosomal proteins   Proteins found in most exosomes    136146879 (CFL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  136146879 NCBI-ProteinID:  XP_065761999 LinkDB All DBs Position 15:complement(42561661..42566121) Genome browser AA seq 166 aa AA seqDB search MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI GDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcttctggagttacagtgaatgatgaagtcatcaaagtttttaatgatatgaaagta aggaaatcttctacacaagaggagatcaaaaaaagaaagaaagcagttctcttctgttta agcgatgacaaaagacaaataattgtagaggaagcaaagcagatcttggtgggtgacatt ggtgatactgtagaggacccctacacatcttttgtgaagttgctacctctgaatgattgc cgatatgctttgtacgatgccacatacgaaacaaaagagtctaagaaagaagacctagta tttatattctgggctcctgaaagtgcgcctttaaaaagcaagatgatatatgctagctct aaagatgccattaaaaagaaatttacaggtataaaacatgagtggcaagtaaatggcttg gatgatataaaggaccgttccacacttggagagaaattgggaggcaacgtagtagtttca cttgaaggaaaacccttataa

DBGET integrated database retrieval system