Muntiacus reevesi (Reeves' muntjac): 136147363 Help Entry 136147363         CDS       T10466                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04024   cAMP signaling pathway mree04062   Chemokine signaling pathway mree04064   NF-kappa B signaling pathway mree04210   Apoptosis mree04380   Osteoclast differentiation mree04620   Toll-like receptor signaling pathway mree04621   NOD-like receptor signaling pathway mree04622   RIG-I-like receptor signaling pathway mree04623   Cytosolic DNA-sensing pathway mree04625   C-type lectin receptor signaling pathway mree04657   IL-17 signaling pathway mree04658   Th1 and Th2 cell differentiation mree04659   Th17 cell differentiation mree04660   T cell receptor signaling pathway mree04662   B cell receptor signaling pathway mree04668   TNF signaling pathway mree04722   Neurotrophin signaling pathway mree04920   Adipocytokine signaling pathway mree04926   Relaxin signaling pathway mree04931   Insulin resistance mree04936   Alcoholic liver disease mree05132   Salmonella infection mree05134   Legionellosis mree05135   Yersinia infection mree05140   Leishmaniasis mree05142   Chagas disease mree05145   Toxoplasmosis mree05160   Hepatitis C mree05161   Hepatitis B mree05162   Measles mree05163   Human cytomegalovirus infection mree05164   Influenza A mree05166   Human T-cell leukemia virus 1 infection mree05167   Kaposi sarcoma-associated herpesvirus infection mree05168   Herpes simplex virus 1 infection mree05169   Epstein-Barr virus infection mree05170   Human immunodeficiency virus 1 infection mree05171   Coronavirus disease - COVID-19 mree05200   Pathways in cancer mree05203   Viral carcinogenesis mree05208   Chemical carcinogenesis - reactive oxygen species mree05215   Prostate cancer mree05220   Chronic myeloid leukemia mree05222   Small cell lung cancer mree05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mree05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     136147363 (NFKBIA)    04668 TNF signaling pathway     136147363 (NFKBIA)    04024 cAMP signaling pathway     136147363 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     136147363 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     136147363 (NFKBIA)    04621 NOD-like receptor signaling pathway     136147363 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     136147363 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     136147363 (NFKBIA)    04625 C-type lectin receptor signaling pathway     136147363 (NFKBIA)    04660 T cell receptor signaling pathway     136147363 (NFKBIA)    04658 Th1 and Th2 cell differentiation     136147363 (NFKBIA)    04659 Th17 cell differentiation     136147363 (NFKBIA)    04657 IL-17 signaling pathway     136147363 (NFKBIA)    04662 B cell receptor signaling pathway     136147363 (NFKBIA)    04062 Chemokine signaling pathway     136147363 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     136147363 (NFKBIA)    04926 Relaxin signaling pathway     136147363 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     136147363 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     136147363 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136147363 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     136147363 (NFKBIA)    05203 Viral carcinogenesis     136147363 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     136147363 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     136147363 (NFKBIA)    05215 Prostate cancer     136147363 (NFKBIA)    05222 Small cell lung cancer     136147363 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     136147363 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     136147363 (NFKBIA)    05161 Hepatitis B     136147363 (NFKBIA)    05160 Hepatitis C     136147363 (NFKBIA)    05171 Coronavirus disease - COVID-19     136147363 (NFKBIA)    05164 Influenza A     136147363 (NFKBIA)    05162 Measles     136147363 (NFKBIA)    05168 Herpes simplex virus 1 infection     136147363 (NFKBIA)    05163 Human cytomegalovirus infection     136147363 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     136147363 (NFKBIA)    05169 Epstein-Barr virus infection     136147363 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     136147363 (NFKBIA)    05135 Yersinia infection     136147363 (NFKBIA)    05134 Legionellosis     136147363 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     136147363 (NFKBIA)    05140 Leishmaniasis     136147363 (NFKBIA)    05142 Chagas disease     136147363 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136147363 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     136147363 (NFKBIA)    04931 Insulin resistance     136147363 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mree03000]     136147363 (NFKBIA)    04131 Membrane trafficking [BR:mree04131]     136147363 (NFKBIA) Transcription factors [BR:mree03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     136147363 (NFKBIA) Membrane trafficking [BR:mree04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     136147363 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  136147363 NCBI-ProteinID:  XP_065762818 LinkDB All DBs Position 15:complement(43071755..43075176) Genome browser AA seq 314 aa AA seqDB search MFQPAEPGQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQHLHSILQSTN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQTLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcctgccgagcccggccaagattgggccatggagggcccccgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtatgagcagatggtgaaggagctgcgagagatccgcctggagccgcaggaggcgccg cgcggcgccgagccctggaaacagcagctcacggaggacggagactcgttcctgcacttg gccatcatccacgaagagaaggcgctgaccatggaagtggtccgccaagtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagacaccactccacttggctgtgatc actaaccagccagaaatcgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagcgtg ggagtcctgactcagccccgggggacccagcacctccactccatcctgcagtctaccaac tataatggccacacgtgtctgcacttggcctctattcatggctacctgggcatcgtggag ctgttggtgtccttgggcgctgatgtcaacgctcaggagccctgcaatggccgaactgcc ctccatctggcagtggacctgcagaaccccgacctggtgtcactcctgttgaagtgtggg gccgatgtcaacagggtcacctaccagggctactcaccataccagctcacgtggggccgc cccagcacgcggatacagcagcagctgggccagctgaccctagagaacctgcagacgctg ccagagagtgaggatgaggagagctatgacaccgagtcagagttcaccgaggacgagctt ccctacgatgactgtgtgcttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system