Muntiacus reevesi (Reeves' muntjac): 136147842 Help Entry 136147842         CDS       T10466                                  Symbol H2AZ1 Name (RefSeq) histone H2A.Z   KO K11251   histone H2A Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree03082   ATP-dependent chromatin remodeling mree04217   Necroptosis mree04613   Neutrophil extracellular trap formation mree05034   Alcoholism mree05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mree00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     136147842 (H2AZ1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     136147842 (H2AZ1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     136147842 (H2AZ1)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     136147842 (H2AZ1)   09165 Substance dependence    05034 Alcoholism     136147842 (H2AZ1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mree03036]     136147842 (H2AZ1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mree04147]     136147842 (H2AZ1) Chromosome and associated proteins [BR:mree03036]  Eukaryotic type   Nucleosome assembly factors    Histones     136147842 (H2AZ1) Exosome [BR:mree04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136147842 (H2AZ1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  136147842 NCBI-ProteinID:  XP_065763248 LinkDB All DBs Position 16:23860409..23862654 Genome browser AA seq 128 aa AA seqDB search MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggcggtaaggctgggaaggactccggaaaggccaagacaaaggcggtttcccgc tcgcagagagccggtttgcagttcccggtgggccgtattcatcgacacctgaaatctagg acgaccagccatggacgtgtgggcgcgactgccgctgtgtacagcgcagccatcctggag tacctcaccgcagaggtacttgaattggcaggaaacgcatcgaaagacttgaaggtaaag cgtattacccctcgtcacttgcaacttgctattcgtggagatgaagaattggactctctc atcaaggctacaattgctggtggtggtgtcattccacacatccacaaatctctgattggg aagaaaggacaacagaagactgtctaa

DBGET integrated database retrieval system