Muntiacus reevesi (Reeves' muntjac): 136148486 Help Entry 136148486         CDS       T10466                                  Name (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04060   Cytokine-cytokine receptor interaction mree04151   PI3K-Akt signaling pathway mree04217   Necroptosis mree04620   Toll-like receptor signaling pathway mree04621   NOD-like receptor signaling pathway mree04622   RIG-I-like receptor signaling pathway mree04623   Cytosolic DNA-sensing pathway mree04630   JAK-STAT signaling pathway mree04650   Natural killer cell mediated cytotoxicity mree04936   Alcoholic liver disease mree05152   Tuberculosis mree05160   Hepatitis C mree05161   Hepatitis B mree05162   Measles mree05163   Human cytomegalovirus infection mree05164   Influenza A mree05165   Human papillomavirus infection mree05167   Kaposi sarcoma-associated herpesvirus infection mree05168   Herpes simplex virus 1 infection mree05169   Epstein-Barr virus infection mree05170   Human immunodeficiency virus 1 infection mree05171   Coronavirus disease - COVID-19 mree05200   Pathways in cancer mree05320   Autoimmune thyroid disease mree05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     136148486    04151 PI3K-Akt signaling pathway     136148486   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136148486  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     136148486  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     136148486    04621 NOD-like receptor signaling pathway     136148486    04622 RIG-I-like receptor signaling pathway     136148486    04623 Cytosolic DNA-sensing pathway     136148486    04650 Natural killer cell mediated cytotoxicity     136148486  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136148486   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     136148486    05161 Hepatitis B     136148486    05160 Hepatitis C     136148486    05171 Coronavirus disease - COVID-19     136148486    05164 Influenza A     136148486    05162 Measles     136148486    05168 Herpes simplex virus 1 infection     136148486    05163 Human cytomegalovirus infection     136148486    05167 Kaposi sarcoma-associated herpesvirus infection     136148486    05169 Epstein-Barr virus infection     136148486    05165 Human papillomavirus infection     136148486   09171 Infectious disease: bacterial    05152 Tuberculosis     136148486   09163 Immune disease    05320 Autoimmune thyroid disease     136148486   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136148486   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     136148486  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mree04052]     136148486 Cytokines and neuropeptides [BR:mree04052]  Cytokines   Interferons    136148486 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  136148486 NCBI-ProteinID:  XP_065764131 LinkDB All DBs Position 17:21484989..21485590 Genome browser AA seq 189 aa AA seqDB search MAPAWSSLLALLLLSCNSICSLGCHLPHTHSLANRRVLTLLRHLRMVSPSSCLQDRNDFA FPQEALGGSQLQRAQAISVLHEVTQHTFQLFSTQGSAAVWDQSLLDKLRTALDQQLTDLQ ACLRQEQGLQGAPLLKGDSSLALRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSTN LQERFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtcctcactcctggccctgctgctgctcagctgcaactccatctgc tctctgggctgccacctgcctcacacccacagcctggccaacaggagggtcctgacgctc ctgcgacacctgaggatggtctccccttcctcctgcctgcaggacagaaatgacttcgcc ttcccccaggaggcgctgggtggcagccagttgcagagggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcactcagggctcggccgctgtgtgg gaccagagcctcctggacaagctccgcactgcactggaccagcagctcactgacctgcaa gcctgtctgaggcaggagcaggggctgcaaggggctcccctgctcaagggggactccagc ctggctctgaggaaatacttccacagagtcactctctatcttcaagagaagggacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattccggaggaaggactga

DBGET integrated database retrieval system