KEGG   Muntiacus reevesi (Reeves' muntjac): 136148762
Entry
136148762         CDS       T10466                                 
Symbol
NDUFB6
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
  KO
K03962  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 6
Organism
mree  Muntiacus reevesi (Reeves' muntjac)
Pathway
mree00190  Oxidative phosphorylation
mree01100  Metabolic pathways
mree04714  Thermogenesis
mree04723  Retrograde endocannabinoid signaling
mree04932  Non-alcoholic fatty liver disease
mree05010  Alzheimer disease
mree05012  Parkinson disease
mree05014  Amyotrophic lateral sclerosis
mree05016  Huntington disease
mree05020  Prion disease
mree05022  Pathways of neurodegeneration - multiple diseases
mree05208  Chemical carcinogenesis - reactive oxygen species
mree05415  Diabetic cardiomyopathy
Module
mree_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mree00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    136148762 (NDUFB6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    136148762 (NDUFB6)
  09159 Environmental adaptation
   04714 Thermogenesis
    136148762 (NDUFB6)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    136148762 (NDUFB6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    136148762 (NDUFB6)
   05012 Parkinson disease
    136148762 (NDUFB6)
   05014 Amyotrophic lateral sclerosis
    136148762 (NDUFB6)
   05016 Huntington disease
    136148762 (NDUFB6)
   05020 Prion disease
    136148762 (NDUFB6)
   05022 Pathways of neurodegeneration - multiple diseases
    136148762 (NDUFB6)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    136148762 (NDUFB6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    136148762 (NDUFB6)
SSDB
Motif
Pfam: NDUF_B6 DUF735
Other DBs
NCBI-GeneID: 136148762
NCBI-ProteinID: XP_065764506
LinkDB
Position
17:10816770..10829923
AA seq 128 aa
MSGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQRVSPVERFWNKFLQDGALWKNV
IYKTYRHSIFAFTHVLIPVWIIHYYLKYHVTTKPYTIVEKKPRIFPGDTILETGEVIPPM
KEFPDQHH
NT seq 387 nt   +upstreamnt  +downstreamnt
atgtcggggtatacgcccgacgagaaactgcggctgcagcagctgcgagagctgagaagg
cgatggctgaaagatcaggagctgagcccccgggaaccggtgctgcctccgcagagggtg
tcgcctgtggagcgattctggaataaatttttgcaagacggagctctctggaagaacgtg
atctataagacataccgacacagtatctttgcttttactcatgtacttattcctgtctgg
attattcattattatctcaagtatcatgtgactacaaaaccatataccatcgttgaaaag
aagcccagaatatttccaggtgatacaattctggagactggagaagtaatcccacccatg
aaagaatttcctgatcaacatcattga

DBGET integrated database retrieval system