Muntiacus reevesi (Reeves' muntjac): 136149099 Help Entry 136149099         CDS       T10466                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04015   Rap1 signaling pathway mree04810   Regulation of actin cytoskeleton mree05014   Amyotrophic lateral sclerosis mree05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     136149099 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     136149099 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     136149099 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     136149099 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mree04131]     136149099 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mree04812]     136149099 (PFN1)    04147 Exosome [BR:mree04147]     136149099 (PFN1) Membrane trafficking [BR:mree04131]  Others   Actin-binding proteins    Others     136149099 (PFN1) Cytoskeleton proteins [BR:mree04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      136149099 (PFN1) Exosome [BR:mree04147]  Exosomal proteins   Proteins found in most exosomes    136149099 (PFN1) SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  136149099 NCBI-ProteinID:  XP_065765102 LinkDB All DBs Position 18:complement(35494805..35497703) Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgca gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccggcaagaccttc gtcaacatcacgcctgctgaggtcggtatcctggttggcaaagaccggtcaagttttttc gtgaacgggctaacgcttgggggccagaaatgttctgtgatccgggactcactgctgcag gacggagaatttaccatggatcttcgtaccaagagcaccggtggagccccaaccttcaat atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggcggtatgatcaacaagaaatgttatgaaatggcttctcacctgcggcgttcccagtac tga

DBGET integrated database retrieval system