Muntiacus reevesi (Reeves' muntjac): 136149377 Help Entry 136149377         CDS       T10466                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04081   Hormone signaling mree04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     136149377 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     136149377 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mree04052]     136149377 (GAST) Cytokines and neuropeptides [BR:mree04052]  Neuropeptides   GPCR binding    136149377 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  136149377 NCBI-ProteinID:  XP_065765678 LinkDB All DBs Position 18:complement(20567328..20574579) Genome browser AA seq 104 aa AA seqDB search MQRLCAYALILVLALAAFCEASWKPHSQLQDAPVAPGANRGQEPLRMDRLGPASHPRRQL GLQDPPHVVADLSKKQGPWVEEEEAAYGWMDFGRRSAEEGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgcatatgcgctgatcttggtgctggctctggccgccttctgcgaa gcttcttggaagccccactcccagctgcaagatgcgcccgttgctccaggagccaatagg ggccaggagccgctcaggatggaccggctgggcccagcctcgcacccccggaggcagctg gggcttcaggatccgccacacgtggtcgcagacctgtccaagaagcaggggccatgggtg gaggaagaggaagcagcttatggatggatggacttcggccgccgcagtgctgaagaaggg gaccaacatccctga

DBGET integrated database retrieval system