Muntiacus reevesi (Reeves' muntjac): 136149430 Help Entry 136149430         CDS       T10466                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04060   Cytokine-cytokine receptor interaction mree04061   Viral protein interaction with cytokine and cytokine receptor mree04062   Chemokine signaling pathway mree04620   Toll-like receptor signaling pathway mree05142   Chagas disease mree05163   Human cytomegalovirus infection mree05323   Rheumatoid arthritis mree05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136149430    04061 Viral protein interaction with cytokine and cytokine receptor     136149430  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     136149430    04062 Chemokine signaling pathway     136149430  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     136149430   09174 Infectious disease: parasitic    05142 Chagas disease     136149430   09163 Immune disease    05323 Rheumatoid arthritis     136149430   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136149430  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mree04052]     136149430    00536 Glycosaminoglycan binding proteins [BR:mree00536]     136149430 Cytokines and neuropeptides [BR:mree04052]  Cytokines   Chemokines    136149430 Glycosaminoglycan binding proteins [BR:mree00536]  Heparan sulfate / Heparin   Chemokines    136149430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Duc1_FFAT_like Motif Other DBs NCBI-GeneID:  136149430 NCBI-ProteinID:  XP_065765746 LinkDB All DBs Position 18:complement(47359208..47361160) Genome browser AA seq 93 aa AA seqDB search MKAPATVLAVLLCAMALGSQVFSAPFGADTPTACCFSYTARQLPRKFVADYYETSSQCSK PGVIFQTKRGRELCADPNEDWVQKYITDLELNL NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggcgcccgcgactgtcctcgctgttctcctctgtgccatggccctcggcagccag gtcttctcggcaccatttggcgctgacaccccaacggcctgctgcttctcctacaccgcc cggcagcttcctcgcaaattcgtagccgactattatgagaccagcagccagtgctccaag cctggcgtcatcttccaaaccaaaagaggccgggagctctgtgccgaccccaacgaggac tgggtccagaaatacatcaccgacctggagctgaatctctga

DBGET integrated database retrieval system