Muntiacus reevesi (Reeves' muntjac): 136149586 Help Entry 136149586         CDS       T10466                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04014   Ras signaling pathway mree04137   Mitophagy - animal mree04144   Endocytosis mree04145   Phagosome mree04148   Efferocytosis mree04962   Vasopressin-regulated water reabsorption mree05132   Salmonella infection mree05146   Amoebiasis mree05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     136149586 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     136149586 (RAB5C)    04145 Phagosome     136149586 (RAB5C)    04137 Mitophagy - animal     136149586 (RAB5C)    04148 Efferocytosis     136149586 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     136149586 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     136149586 (RAB5C)    05152 Tuberculosis     136149586 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     136149586 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mree04131]     136149586 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mree04147]     136149586 (RAB5C)    04031 GTP-binding proteins [BR:mree04031]     136149586 (RAB5C) Membrane trafficking [BR:mree04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     136149586 (RAB5C)  Endosome - Lysosome transport     136149586 (RAB5C) Exosome [BR:mree04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136149586 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    136149586 (RAB5C)   Exosomal proteins of colorectal cancer cells    136149586 (RAB5C)   Exosomal proteins of bladder cancer cells    136149586 (RAB5C) GTP-binding proteins [BR:mree04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     136149586 (RAB5C) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  136149586 NCBI-ProteinID:  XP_065766048 LinkDB All DBs Position 18:20225874..20247314 Genome browser AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYAEDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNAAGAPGRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggcgcagcacgacccaacggaccagctgctgggaacaagatctgt cagtttaagctggtcctgctgggggagtccgcggtcggcaaatccagcctcgtcctccgc ttcgtcaaggggcagttccacgagtaccaggagagcacaattggagcggccttcctcaca cagaccgtctgcttggacgacacaacagtcaagtttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc tacgacatcaccaacacagataccttcgcccgggccaagaactgggtgaaggagctacag aggcaggccagtcccaacatcgtcatcgcgctcgcaggcaacaaggcggacctggccagc aagagagctgtggagttccaggaagcacaagcctatgcagaggacaacagtttgctgttc atggagacatcagcaaagactgcgatgaacgtgaatgaaattttcatggcaatagctaag aagcttcccaagaacgaaccccagaatgcagctggtgctccgggccggaaccgaggcgtg gacctccaggagaacaaccctgccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system