Muntiacus reevesi (Reeves' muntjac): 136151647 Help Entry 136151647         CDS       T10466                                  Name (RefSeq) histone H2B type 1-A-like   KO K11252   histone H2B Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04613   Neutrophil extracellular trap formation mree05034   Alcoholism mree05203   Viral carcinogenesis mree05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mree00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     136151647  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     136151647   09163 Immune disease    05322 Systemic lupus erythematosus     136151647   09165 Substance dependence    05034 Alcoholism     136151647  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mree03036]     136151647   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mree04147]     136151647 Chromosome and associated proteins [BR:mree03036]  Eukaryotic type   Nucleosome assembly factors    Histones     136151647 Exosome [BR:mree04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136151647 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  136151647 NCBI-ProteinID:  XP_065769015 LinkDB All DBs Position 20:32822229..32822612 Genome browser AA seq 127 aa AA seqDB search MPELTTKGTAISKKGFKKAVTKTQKKEGKKRKRCRKESFSVYIYKVLKQVHPDTGISSKA MSIMNSFVSDIFERIAGEASRLAHYNKRCTITSREIQTAVRLMLPGELAKHAVSEGTKAV TKYTSCK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgccagagctgactacaaagggcactgccatttctaaaaaaggcttcaagaaagctgta actaaaacccagaagaaggaagggaaaaagcggaagagatgtcggaaagagagcttttca gtttacatctacaaggtgttgaagcaagttcacccagatacgggcatctcttcaaaggct atgagcatcatgaattcctttgtcagtgacattttcgagcgcatagcaggtgaggcgtcg cgactggcacattataacaagcgctgcactatcacgtccagggagatccagacggccgtg cgcctgatgctacctggggagctggccaaacacgcagtgtccgagggcaccaaggctgtc accaagtacaccagctgcaagtaa

DBGET integrated database retrieval system