Muntiacus reevesi (Reeves' muntjac): 136151922 Help Entry 136151922         CDS       T10466                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04613   Neutrophil extracellular trap formation mree05034   Alcoholism mree05203   Viral carcinogenesis mree05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mree00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     136151922  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     136151922   09163 Immune disease    05322 Systemic lupus erythematosus     136151922   09165 Substance dependence    05034 Alcoholism     136151922  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mree03036]     136151922 Chromosome and associated proteins [BR:mree03036]  Eukaryotic type   Nucleosome assembly factors    Histones     136151922 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  136151922 NCBI-ProteinID:  XP_065769449 LinkDB All DBs Position 20:complement(32591854..32592187) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtcgggacgcggcaaaggcggcaaaggcctggggaaaggcggcgctaaacgccaccgt aaggttctgcgcgacaacatccagggcatcactaagcctgctatccgccgcctggctcgt cgtggcggtgtgaagcgcatctctgggctcatctacgaagagacgcgcggcgttctgaaa gtgtttctggagaacgtgatccgggatgcagtcacctacaccgagcatgctaagcggaag actgttaccgctatggacgtggtctacgctctcaagcgccagggccgtaccctctacggt tttggtggttaa

DBGET integrated database retrieval system