Muntiacus reevesi (Reeves' muntjac): 136153175 Help Entry 136153175         CDS       T10466                                  Symbol APLN Name (RefSeq) apelin   KO K05225   apelin Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04080   Neuroactive ligand-receptor interaction mree04371   Apelin signaling pathway Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     136153175 (APLN)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     136153175 (APLN)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mree04052]     136153175 (APLN) Cytokines and neuropeptides [BR:mree04052]  Neuropeptides   GPCR binding    136153175 (APLN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Apelin Motif Other DBs NCBI-GeneID:  136153175 NCBI-ProteinID:  XP_065770834 LinkDB All DBs Position X:121700492..121709654 Genome browser AA seq 77 aa AA seqDB search MNLRLCVQALLLLWLCLSAACGGPLLQTSDGKEMEEGTIRYLVQPRGPRSGPGPWQGGRR KFRRQRPRLSHKGPMPF NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaatctgcggctctgcgtgcaggcgctcctgctgctctggctctgcctgagcgcggcg tgcggaggacccctgctgcagacttctgacgggaaggagatggaagaaggcaccatccgc tacctggtgcagcccagggggccgaggagcggcccagggccctggcagggaggtcggagg aagttccggcgccagcggccacgcctctcccacaagggccccatgcctttctga

DBGET integrated database retrieval system