Muntiacus reevesi (Reeves' muntjac): 136157257 Help Entry 136157257         CDS       T10466                                  Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree01521   EGFR tyrosine kinase inhibitor resistance mree01524   Platinum drug resistance mree04014   Ras signaling pathway mree04064   NF-kappa B signaling pathway mree04115   p53 signaling pathway mree04137   Mitophagy - animal mree04140   Autophagy - animal mree04151   PI3K-Akt signaling pathway mree04210   Apoptosis mree04215   Apoptosis - multiple species mree04621   NOD-like receptor signaling pathway mree04630   JAK-STAT signaling pathway mree05012   Parkinson disease mree05014   Amyotrophic lateral sclerosis mree05022   Pathways of neurodegeneration - multiple diseases mree05145   Toxoplasmosis mree05162   Measles mree05166   Human T-cell leukemia virus 1 infection mree05168   Herpes simplex virus 1 infection mree05170   Human immunodeficiency virus 1 infection mree05200   Pathways in cancer mree05202   Transcriptional misregulation in cancer mree05212   Pancreatic cancer mree05220   Chronic myeloid leukemia mree05222   Small cell lung cancer mree05225   Hepatocellular carcinoma mree05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     136157257    04630 JAK-STAT signaling pathway     136157257    04064 NF-kappa B signaling pathway     136157257    04151 PI3K-Akt signaling pathway     136157257  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     136157257    04137 Mitophagy - animal     136157257   09143 Cell growth and death    04210 Apoptosis     136157257    04215 Apoptosis - multiple species     136157257    04115 p53 signaling pathway     136157257  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     136157257  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136157257    05202 Transcriptional misregulation in cancer     136157257   09162 Cancer: specific types    05212 Pancreatic cancer     136157257    05225 Hepatocellular carcinoma     136157257    05220 Chronic myeloid leukemia     136157257    05222 Small cell lung cancer     136157257   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     136157257    05170 Human immunodeficiency virus 1 infection     136157257    05162 Measles     136157257    05168 Herpes simplex virus 1 infection     136157257   09174 Infectious disease: parasitic    05145 Toxoplasmosis     136157257   09164 Neurodegenerative disease    05012 Parkinson disease     136157257    05014 Amyotrophic lateral sclerosis     136157257    05022 Pathways of neurodegeneration - multiple diseases     136157257   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136157257   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     136157257    01524 Platinum drug resistance     136157257  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mree01009]     136157257   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mree03036]     136157257   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mree02000]     136157257 Protein phosphatases and associated proteins [BR:mree01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      136157257 Chromosome and associated proteins [BR:mree03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     136157257 Transporters [BR:mree02000]  Other transporters   Pores ion channels [TC:1]    136157257 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BH4 Motif Other DBs NCBI-GeneID:  136157257 NCBI-ProteinID:  XP_065775289 LinkDB All DBs Position 2:125010131..125010808 Genome browser AA seq 173 aa AA seqDB search MSQNNWELVVDFLSYKLSQKGYSWSQFSDVEENRTEASEGTESDMEIPRAINGNPSWHLA DNPAVNGATGHSRSLDAWKVIPTVAVKQTLREANDEFELRYRRTFSDLMSQLHIPPGIAY QSFEQNGVWDTFVELYGNNATAESWKGQERFNRWFLISMTVAGMVLLGSLFNS NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgtctcagaacaactgggagctggtggttgactttctctcttacaagctttcccagaaa ggatacagttggagtcagtttagtgacgtggaagagaacagaactgaggcctcagaaggg acagaatcagatatggaaatccccagagccatcaatggcaacccatcctggcacctggca gataatcctgcggtgaatggagccactggccacagtagaagcttggatgcttggaaagtg atccccacggtagcagtgaagcaaaccctgagggaggcaaacgatgagtttgaactgagg taccgacggacattcagcgacctgatgtctcagctccacatccccccagggatagcatat cagagctttgaacagaatggtgtctgggacacttttgtggaactctacggaaacaatgca acagctgagagctggaagggccaggagcgcttcaaccgctggtttctgattagcatgact gtggctggtatggttctgctgggctctctctttaactcatag

DBGET integrated database retrieval system