Muntiacus reevesi (Reeves' muntjac): 136157531 Help Entry 136157531         CDS       T10466                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04010   MAPK signaling pathway mree04014   Ras signaling pathway mree04015   Rap1 signaling pathway mree04024   cAMP signaling pathway mree04072   Phospholipase D signaling pathway mree04137   Mitophagy - animal mree04140   Autophagy - animal mree04218   Cellular senescence mree04360   Axon guidance mree04371   Apelin signaling pathway mree04625   C-type lectin receptor signaling pathway mree04810   Regulation of actin cytoskeleton mree05132   Salmonella infection mree05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     136157531 (RRAS)    04014 Ras signaling pathway     136157531 (RRAS)    04015 Rap1 signaling pathway     136157531 (RRAS)    04371 Apelin signaling pathway     136157531 (RRAS)    04072 Phospholipase D signaling pathway     136157531 (RRAS)    04024 cAMP signaling pathway     136157531 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     136157531 (RRAS)    04137 Mitophagy - animal     136157531 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     136157531 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     136157531 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     136157531 (RRAS)   09158 Development and regeneration    04360 Axon guidance     136157531 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     136157531 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     136157531 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mree04031]     136157531 (RRAS) GTP-binding proteins [BR:mree04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     136157531 (RRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc MMR_HSR1 GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  136157531 NCBI-ProteinID:  XP_065775461 LinkDB All DBs Position 2:complement(268073533..268076940) Genome browser AA seq 183 aa AA seqDB search MSSGAASGTGRGRPRGGVPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGVPARLDILDTAGQEEFGAMREQYLRAGHGFLLVFAINDRQRKVPRS EASTFSASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKARGCPC VLL NT seq 552 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcggggtgccggga cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcactgaccatccagttcatccagtcctacttcgtgtctgactacgacccc actattgaagactcctacacgaagatctgcactgtggatggtgtgccagcccggctagac atcctggacaccgctggccaggaggaatttggtgccatgcgggaacagtacttgcgtgca ggccacggcttcctgctggtgtttgccattaatgacaggcagaggaaggtcccccgatct gaagcctccaccttcagtgcctcccaccacgtggcctacttcgaagcttccgccaaactg cgcctcaatgtggatgaggccttcgagcagctggtgcgggccgtccggaagtaccaggaa caagagctcccgccctccccgcccagcgcccccaggaagaaggccagaggctgcccctgt gtcctcctgtag

DBGET integrated database retrieval system