Muntiacus reevesi (Reeves' muntjac): 136158488 Help Entry 136158488         CDS       T10466                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04014   Ras signaling pathway mree04015   Rap1 signaling pathway mree04020   Calcium signaling pathway mree04022   cGMP-PKG signaling pathway mree04024   cAMP signaling pathway mree04070   Phosphatidylinositol signaling system mree04114   Oocyte meiosis mree04218   Cellular senescence mree04261   Adrenergic signaling in cardiomyocytes mree04270   Vascular smooth muscle contraction mree04371   Apelin signaling pathway mree04625   C-type lectin receptor signaling pathway mree04713   Circadian entrainment mree04720   Long-term potentiation mree04722   Neurotrophin signaling pathway mree04728   Dopaminergic synapse mree04740   Olfactory transduction mree04744   Phototransduction mree04750   Inflammatory mediator regulation of TRP channels mree04910   Insulin signaling pathway mree04912   GnRH signaling pathway mree04915   Estrogen signaling pathway mree04916   Melanogenesis mree04921   Oxytocin signaling pathway mree04922   Glucagon signaling pathway mree04924   Renin secretion mree04925   Aldosterone synthesis and secretion mree04970   Salivary secretion mree04971   Gastric acid secretion mree05010   Alzheimer disease mree05012   Parkinson disease mree05022   Pathways of neurodegeneration - multiple diseases mree05031   Amphetamine addiction mree05034   Alcoholism mree05133   Pertussis mree05152   Tuberculosis mree05163   Human cytomegalovirus infection mree05167   Kaposi sarcoma-associated herpesvirus infection mree05170   Human immunodeficiency virus 1 infection mree05200   Pathways in cancer mree05214   Glioma mree05417   Lipid and atherosclerosis mree05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     136158488    04015 Rap1 signaling pathway     136158488    04371 Apelin signaling pathway     136158488    04020 Calcium signaling pathway     136158488    04070 Phosphatidylinositol signaling system     136158488    04024 cAMP signaling pathway     136158488    04022 cGMP-PKG signaling pathway     136158488  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     136158488    04218 Cellular senescence     136158488  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     136158488   09152 Endocrine system    04910 Insulin signaling pathway     136158488    04922 Glucagon signaling pathway     136158488    04912 GnRH signaling pathway     136158488    04915 Estrogen signaling pathway     136158488    04921 Oxytocin signaling pathway     136158488    04916 Melanogenesis     136158488    04924 Renin secretion     136158488    04925 Aldosterone synthesis and secretion     136158488   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     136158488    04270 Vascular smooth muscle contraction     136158488   09154 Digestive system    04970 Salivary secretion     136158488    04971 Gastric acid secretion     136158488   09156 Nervous system    04728 Dopaminergic synapse     136158488    04720 Long-term potentiation     136158488    04722 Neurotrophin signaling pathway     136158488   09157 Sensory system    04744 Phototransduction     136158488    04740 Olfactory transduction     136158488    04750 Inflammatory mediator regulation of TRP channels     136158488   09159 Environmental adaptation    04713 Circadian entrainment     136158488  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136158488   09162 Cancer: specific types    05214 Glioma     136158488   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     136158488    05163 Human cytomegalovirus infection     136158488    05167 Kaposi sarcoma-associated herpesvirus infection     136158488   09171 Infectious disease: bacterial    05133 Pertussis     136158488    05152 Tuberculosis     136158488   09164 Neurodegenerative disease    05010 Alzheimer disease     136158488    05012 Parkinson disease     136158488    05022 Pathways of neurodegeneration - multiple diseases     136158488   09165 Substance dependence    05031 Amphetamine addiction     136158488    05034 Alcoholism     136158488   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136158488    05418 Fluid shear stress and atherosclerosis     136158488  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mree01009]     136158488   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mree04131]     136158488    03036 Chromosome and associated proteins [BR:mree03036]     136158488   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mree04147]     136158488 Protein phosphatases and associated proteins [BR:mree01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      136158488 Membrane trafficking [BR:mree04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     136158488 Chromosome and associated proteins [BR:mree03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      136158488 Exosome [BR:mree04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    136158488 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 EF-hand_FSTL1 SPARC_Ca_bdg EH SAPC2_N EF-hand_STIM1 EF_EFCAB10_C DUF5580_M EF-hand_11 EF-hand_EFHB_C CFAP251_C Dockerin_1 MTIP_N Caleosin Phage_TAC_12 EAP30 SPEF2_C EF-hand_SWAP70_N RSA-1_C PTS_2-RNA ExbD SPM MmeI_hel Motif Other DBs NCBI-GeneID:  136158488 NCBI-ProteinID:  XP_065776373 LinkDB All DBs Position 2:41925212..41925661 Genome browser AA seq 149 aa AA seqDB search MAEKLSEEQVAEFKKAFDRFDKDKDGTISVQDLGTVMEELGLKPSEAELEGVISQLDMDN NGVISFQEFLGAMASELQTSATEEGLREIFRALDQDNDGYISVDELRQATSQLEEKMSQE ELDAMIREADVDQDGRVNYKEFVRILTQN NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagaaaagctgtccgaagagcaggtggcggagttcaagaaggccttcgacagattc gacaaggacaaggacggcaccatcagtgtgcaggatctgggcaccgtgatggaggagctg ggactgaagccgtcagaggctgagctggagggggtcatctcccagctggacatggacaac aacggcgtaatcagcttccaggagttcctgggggccatggcctcagagcttcagacctcg gccacggaggagggcctgcgggaaatcttccgtgccttagaccaggacaacgatggctac atcagcgtggatgagctcaggcaggccacgtcccagctggaggagaagatgtctcaggaa gagctggatgccatgatccgggaggcggacgtggaccaagacggccgggtgaactacaag gagttcgtgcgcatcctcacccagaactga

DBGET integrated database retrieval system