Muntiacus reevesi (Reeves' muntjac): 136158583 Help Entry 136158583         CDS       T10466                                  Symbol MYL10 Name (RefSeq) myosin regulatory light chain 10   KO K12756   myosin regulatory light chain 10 Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04510   Focal adhesion mree04520   Adherens junction mree04670   Leukocyte transendothelial migration mree04810   Regulation of actin cytoskeleton mree04814   Motor proteins mree05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mree00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     136158583 (MYL10)    04520 Adherens junction     136158583 (MYL10)   09142 Cell motility    04814 Motor proteins     136158583 (MYL10)    04810 Regulation of actin cytoskeleton     136158583 (MYL10)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     136158583 (MYL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     136158583 (MYL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mree04812]     136158583 (MYL10) Cytoskeleton proteins [BR:mree04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      136158583 (MYL10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 SAPC2_N EF_EFCAB10_C EF-hand_FSTL1 AIF-1 Motif Other DBs NCBI-GeneID:  136158583 NCBI-ProteinID:  XP_065776470 LinkDB All DBs Position 2:213250574..213259954 Genome browser AA seq 147 aa AA seqDB search MFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINF TVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADFIKEKLMTQADRFSEEEVKQMF AAFPPDVCGNLDYRNLCYVITHGEEKD NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgttcgatcagtcccagatccaggagtttaaagaggccttcaccatcatggaccagaac cgggacggcttcatcgacaaggaggacctgagggacacctttgctgccctgggccgcatc aatgtaaagaacgaggagctggaggccatggtgaaggaggcccctgggcccatcaacttc accgtcttcctgaccatgtttggggagaagctgaaggggacggaccccgaggagaccatt ctccacgccttcaaggtgttcgacactgaagggaaaggttttgtcaaggctgatttcatc aaagagaagctcatgacgcaggcagaccggttcagtgaggaggaggtcaagcagatgttt gctgctttcccgccagatgtgtgtggcaatctggactacaggaacctgtgctacgtcatc acgcatggcgaagagaaggactag

DBGET integrated database retrieval system