Muntiacus reevesi (Reeves' muntjac): 136158688 Help Entry 136158688         CDS       T10466                                  Symbol CCL17 Name (RefSeq) C-C motif chemokine 17   KO K21083   C-C motif chemokine 17 Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04060   Cytokine-cytokine receptor interaction mree04061   Viral protein interaction with cytokine and cytokine receptor mree04062   Chemokine signaling pathway mree04625   C-type lectin receptor signaling pathway mree04657   IL-17 signaling pathway Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136158688 (CCL17)    04061 Viral protein interaction with cytokine and cytokine receptor     136158688 (CCL17)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     136158688 (CCL17)    04657 IL-17 signaling pathway     136158688 (CCL17)    04062 Chemokine signaling pathway     136158688 (CCL17)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mree04052]     136158688 (CCL17) Cytokines and neuropeptides [BR:mree04052]  Cytokines   Chemokines    136158688 (CCL17) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  136158688 NCBI-ProteinID:  XP_065776577 LinkDB All DBs Position 2:238360597..238363554 Genome browser AA seq 99 aa AA seqDB search MAPLKTLLLVALLLGALLQDTHAARAGNVGRECCLQFYKGSIPGKLLVDWYQTPGDCPNK AIVLVTRHGKNICANPNDKNVKRAMKYFQKHRKSPDLAV NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggcccccctgaagacgctgctcctggtcgccctcctcctgggggctctcctgcaggac acccacgcagcccgagcaggcaacgtgggccgggagtgctgcctacagttctacaaagga tccattcccggcaagctgttggtggattggtaccagaccccgggcgattgtcccaacaag gccatcgtgctggtgactcgccatggcaaaaacatttgtgcaaaccccaacgacaaaaat gtgaagagagcaatgaagtacttccagaaacacaggaagtcacctgatctggccgtctag

DBGET integrated database retrieval system