Muntiacus reevesi (Reeves' muntjac): 136160453 Help Entry 136160453         CDS       T10466                                  Symbol ELOB Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04066   HIF-1 signaling pathway mree04120   Ubiquitin mediated proteolysis mree05170   Human immunodeficiency virus 1 infection mree05200   Pathways in cancer mree05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:mree00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     136160453 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     136160453 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136160453 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     136160453 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     136160453 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mree04121]     136160453 (ELOB)    03400 DNA repair and recombination proteins [BR:mree03400]     136160453 (ELOB) Ubiquitin system [BR:mree04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      136160453 (ELOB)    Cul5 complex      136160453 (ELOB) DNA repair and recombination proteins [BR:mree03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      136160453 (ELOB) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  136160453 NCBI-ProteinID:  XP_065780205 LinkDB All DBs Position 2:181654379..181658795 Genome browser AA seq 150 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRAGENCHSAVRWFFPMTPSCGIRCGDCTLGGSTSDEAFEAL RIEPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctcatgatccggcgccacaagaccaccatcttcacggacgccaaggag tcgagcaccgtgttcgagctgaagcgcatcgtcgagggtatcctcaagcggccgccggat gagcagcggctgtacaaggacgaccagcttctggacgacggcaagacgttgggcgagtgt ggcttcaccagtcagacagcacgacctcaggcccccgccactgtggggctagccttcagg gcaggtgaaaactgtcacagtgcagtgaggtggtttttccccatgacccccagctgtggc atacgttgtggtgactgcaccttgggtggcagcacctcagatgaggcattcgaggccctg cgcatcgagcccttctccagcccacctgagctgccggatgtgatgaagccacaggactca ggaagcagcgccaatgaacaggctgtgcagtga

DBGET integrated database retrieval system