Muntiacus reevesi (Reeves' muntjac): 136162876 Help Entry 136162876         CDS       T10466                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree01523   Antifolate resistance mree04010   MAPK signaling pathway mree04060   Cytokine-cytokine receptor interaction mree04064   NF-kappa B signaling pathway mree04217   Necroptosis mree04380   Osteoclast differentiation mree04620   Toll-like receptor signaling pathway mree04621   NOD-like receptor signaling pathway mree04623   Cytosolic DNA-sensing pathway mree04625   C-type lectin receptor signaling pathway mree04640   Hematopoietic cell lineage mree04657   IL-17 signaling pathway mree04659   Th17 cell differentiation mree04668   TNF signaling pathway mree04750   Inflammatory mediator regulation of TRP channels mree04932   Non-alcoholic fatty liver disease mree04933   AGE-RAGE signaling pathway in diabetic complications mree04936   Alcoholic liver disease mree04940   Type I diabetes mellitus mree05010   Alzheimer disease mree05020   Prion disease mree05022   Pathways of neurodegeneration - multiple diseases mree05132   Salmonella infection mree05133   Pertussis mree05134   Legionellosis mree05135   Yersinia infection mree05140   Leishmaniasis mree05142   Chagas disease mree05143   African trypanosomiasis mree05144   Malaria mree05146   Amoebiasis mree05152   Tuberculosis mree05162   Measles mree05163   Human cytomegalovirus infection mree05164   Influenza A mree05168   Herpes simplex virus 1 infection mree05171   Coronavirus disease - COVID-19 mree05321   Inflammatory bowel disease mree05323   Rheumatoid arthritis mree05332   Graft-versus-host disease mree05417   Lipid and atherosclerosis mree05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     136162876 (IL1B)    04064 NF-kappa B signaling pathway     136162876 (IL1B)    04668 TNF signaling pathway     136162876 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136162876 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     136162876 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     136162876 (IL1B)    04620 Toll-like receptor signaling pathway     136162876 (IL1B)    04621 NOD-like receptor signaling pathway     136162876 (IL1B)    04623 Cytosolic DNA-sensing pathway     136162876 (IL1B)    04625 C-type lectin receptor signaling pathway     136162876 (IL1B)    04659 Th17 cell differentiation     136162876 (IL1B)    04657 IL-17 signaling pathway     136162876 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     136162876 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     136162876 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     136162876 (IL1B)    05164 Influenza A     136162876 (IL1B)    05162 Measles     136162876 (IL1B)    05168 Herpes simplex virus 1 infection     136162876 (IL1B)    05163 Human cytomegalovirus infection     136162876 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     136162876 (IL1B)    05135 Yersinia infection     136162876 (IL1B)    05133 Pertussis     136162876 (IL1B)    05134 Legionellosis     136162876 (IL1B)    05152 Tuberculosis     136162876 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     136162876 (IL1B)    05144 Malaria     136162876 (IL1B)    05140 Leishmaniasis     136162876 (IL1B)    05142 Chagas disease     136162876 (IL1B)    05143 African trypanosomiasis     136162876 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     136162876 (IL1B)    05321 Inflammatory bowel disease     136162876 (IL1B)    05332 Graft-versus-host disease     136162876 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     136162876 (IL1B)    05020 Prion disease     136162876 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     136162876 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136162876 (IL1B)    05418 Fluid shear stress and atherosclerosis     136162876 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     136162876 (IL1B)    04936 Alcoholic liver disease     136162876 (IL1B)    04932 Non-alcoholic fatty liver disease     136162876 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     136162876 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     136162876 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mree04052]     136162876 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:mree00536]     136162876 (IL1B) Cytokines and neuropeptides [BR:mree04052]  Cytokines   Interleukins    136162876 (IL1B) Glycosaminoglycan binding proteins [BR:mree00536]  Heparan sulfate / Heparin   Cytokines    136162876 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  136162876 NCBI-ProteinID:  XP_065783376 LinkDB All DBs Position 3:57352193..57388119 Genome browser AA seq 266 aa AA seqDB search MATVPEPINEMMAYYSDENELLFEADGPKQMKSCIQHLNLGSMEVGNIQLQISHQLYNKS FRQVVSVIVAMEKLRNSAYAHVFRDDDLRNVLSFIFEEEPVIFETSSDEFLCDAAVQSVN CKLQDREQKSLVLASPCVLKALHLLSQEMSREVVFCMSFVQAEERDNKIPVALGIRDKNL YLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKDTVEFESVLYPNWYISTSQT EAKPVFLGHFRGGQDITDFRMETLSP NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atggcaactgtacctgaacccatcaacgaaatgatggcttactacagtgacgagaatgag ctgttatttgaggctgatggccccaaacagatgaagagttgcatccaacacctgaacctc ggctccatggaagttggaaacatccagctgcagatttctcaccagctatacaacaaaagc ttcaggcaggtggtgtcggtcatcgtggccatggagaagctgaggaacagtgcctatgca catgtcttccgtgatgatgacctgaggaacgtcctttcattcatcttcgaagaagagcct gtcatcttcgaaacgtcctccgacgagtttctgtgtgatgcagccgtgcagtcagtaaac tgcaaactccaggacagagagcaaaaatccctggtgctggctagcccatgtgtgctgaag gctctccacctcctctcacaggaaatgagccgagaagtggtgttctgcatgagcttcgtg caagcagaggaaagagacaacaagattcctgtggccttgggtatcagggacaagaatcta tacctgtcttgtgtgaagaaaggtgatacgcccaccctgcagctggaggaagtagacccc aaagtctaccccaagaggaatatggaaaagcgatttgtcttctacaagacagaaatcaag gatacagttgagtttgagtctgtcctgtaccctaactggtacatcagcacttctcaaact gaagcaaagcccgtcttcctgggacattttagaggcggccaggatataactgacttcaga atggaaaccctctctccctaa

DBGET integrated database retrieval system