Muntiacus reevesi (Reeves' muntjac): 136163877 Help Entry 136163877         CDS       T10466                                  Symbol PFN4 Name (RefSeq) profilin-4 isoform X1   KO K05759   profilin Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04015   Rap1 signaling pathway mree04810   Regulation of actin cytoskeleton mree05014   Amyotrophic lateral sclerosis mree05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     136163877 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     136163877 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     136163877 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     136163877 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mree04131]     136163877 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mree04812]     136163877 (PFN4)    04147 Exosome [BR:mree04147]     136163877 (PFN4) Membrane trafficking [BR:mree04131]  Others   Actin-binding proteins    Others     136163877 (PFN4) Cytoskeleton proteins [BR:mree04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      136163877 (PFN4) Exosome [BR:mree04147]  Exosomal proteins   Proteins found in most exosomes    136163877 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  136163877 NCBI-ProteinID:  XP_065784737 LinkDB All DBs Position 3:complement(30380331..30389418) Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFSVMPSDVRTLVNGFAKNPLKTR REGLYFKEKDYKCVRADDYSLYAKNENTGVIVVKTHLYLLVATYSEGMYPSVCVEATEKL GDYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagatacactcctgggaacaaagcatgtggacagt gcagccctcatcaaactccaggagagaagcctatgtgtagcatcaccaggatttagtgta atgcccagtgatgtccgaacacttgtaaatgggtttgccaaaaaccctttgaaaaccaga agagaaggattgtatttcaaggagaaggactacaaatgtgtccgggcagatgactattct ctttatgccaagaatgaaaacactggtgtgattgttgtgaagacccatctgtatcttctg gtggcaacttactctgaaggcatgtatcctagtgtctgtgtagaagccacagagaagttg ggagactatctaagaagaaaagggaattaa

DBGET integrated database retrieval system