Muntiacus reevesi (Reeves' muntjac): 136164287 Help Entry 136164287         CDS       T10466                                  Symbol RAB1A Name (RefSeq) ras-related protein Rab-1A   KO K07874   Ras-related protein Rab-1A Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04140   Autophagy - animal mree05014   Amyotrophic lateral sclerosis mree05022   Pathways of neurodegeneration - multiple diseases mree05134   Legionellosis Brite KEGG Orthology (KO) [BR:mree00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     136164287 (RAB1A)  09160 Human Diseases   09171 Infectious disease: bacterial    05134 Legionellosis     136164287 (RAB1A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     136164287 (RAB1A)    05022 Pathways of neurodegeneration - multiple diseases     136164287 (RAB1A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mree04131]     136164287 (RAB1A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mree04147]     136164287 (RAB1A)    04031 GTP-binding proteins [BR:mree04031]     136164287 (RAB1A) Membrane trafficking [BR:mree04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab GTPases     136164287 (RAB1A)  Autophagy   Other autophagy associated proteins     136164287 (RAB1A) Exosome [BR:mree04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136164287 (RAB1A)   Exosomal proteins of other body fluids (saliva and urine)    136164287 (RAB1A)   Exosomal proteins of colorectal cancer cells    136164287 (RAB1A) GTP-binding proteins [BR:mree04031]  Small (monomeric) G-proteins   Rab Family    Rab1/35 [OT]     136164287 (RAB1A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 Gtr1_RagA SRPRB FeoB_N AAA ABC_tran AAA_7 PduV-EutP AAA_16 LANC_like AAA_29 Septin AAA_22 AAA_5 CRAL_TRIO_2 Motif Other DBs NCBI-GeneID:  136164287 NCBI-ProteinID:  XP_065785120 LinkDB All DBs Position 3:41382580..41410994 Genome browser AA seq 205 aa AA seqDB search MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGA TAGGAEKSNVKIQSTPVKQSGGGCC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtccagcatgaatcccgaatatgattatttattcaagttacttctgattggcgactct ggggttggaaagtcttgccttcttcttaggtttgcagatgatacatatacagaaagctac atcagcacaattggtgtggatttcaaaataagaactatagagttagatgggaaaacaatc aaacttcaaatatgggacacagcgggccaagaaagatttcgaacaatcacctccagttat tacagaggagcccatggcatcatagttgtgtatgatgtgacagatcaggagtccttcaat aatgttaaacagtggctgcaggaaatagatcgttatgccagtgaaaatgtcaacaagttg ttggtagggaacaaatgtgatctgaccacaaagaaagtagtagactacacaacagcaaag gaatttgctgattcccttggaattccatttttggaaaccagtgctaagaatgcaacgaat gtagaacagtctttcatgacgatggcagctgagataaaaaagcgaatgggtcctggagca acagctggtggtgccgagaagtccaatgttaaaattcagagcactccggtcaagcagtca ggtggaggttgctgctaa

DBGET integrated database retrieval system