Muntiacus reevesi (Reeves' muntjac): 136167246 Help Entry 136167246         CDS       T10466                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04015   Rap1 signaling pathway mree04810   Regulation of actin cytoskeleton mree05014   Amyotrophic lateral sclerosis mree05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     136167246 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     136167246 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     136167246 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     136167246 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mree04131]     136167246 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mree04812]     136167246 (PFN3)    04147 Exosome [BR:mree04147]     136167246 (PFN3) Membrane trafficking [BR:mree04131]  Others   Actin-binding proteins    Others     136167246 (PFN3) Cytoskeleton proteins [BR:mree04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      136167246 (PFN3) Exosome [BR:mree04147]  Exosomal proteins   Proteins found in most exosomes    136167246 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Terminase-T7_RNaseH-like Motif Other DBs NCBI-GeneID:  136167246 NCBI-ProteinID:  XP_065790775 LinkDB All DBs Position 1:complement(216741152..216741600) Genome browser AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRSTFL QAGLCVAGRRCCVIRDHLLVEGEGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGI LNKTMHELIHGLRSQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaaggttacatcagtgcagtgcttcgggaccagcgcatcgacgacgtg gccatcgtgggccactcggacaatcgctgcgtgtgggcctcgcggcctgggggcctgctg gcggccatctcaccgcaggaggtgggtgtgctcactgggccagaccggagcactttcctg caggcggggctgtgcgtggcgggccgccgttgctgcgtcatccgagaccacctgctggtc gagggcgagggagtgctggacgcgcgcaccaagggtctggacgggcgcgccatctgcgtg ggccacacgcctcgggcgctgctcgtgctcatgggccgacggggcgtgcacgggggcatt ctcaacaagacgatgcacgagctgatccacgggctgcgctcgcagggcacctag

DBGET integrated database retrieval system