Muntiacus reevesi (Reeves' muntjac): 136168871 Help Entry 136168871         CDS       T10466                                  Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree00480   Glutathione metabolism mree00980   Metabolism of xenobiotics by cytochrome P450 mree00982   Drug metabolism - cytochrome P450 mree00983   Drug metabolism - other enzymes mree01100   Metabolic pathways mree01524   Platinum drug resistance mree05200   Pathways in cancer mree05204   Chemical carcinogenesis - DNA adducts mree05215   Prostate cancer mree05225   Hepatocellular carcinoma mree05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mree00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     136168871   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     136168871    00982 Drug metabolism - cytochrome P450     136168871    00983 Drug metabolism - other enzymes     136168871  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136168871    05204 Chemical carcinogenesis - DNA adducts     136168871   09162 Cancer: specific types    05225 Hepatocellular carcinoma     136168871    05215 Prostate cancer     136168871   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     136168871   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     136168871  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mree02000]     136168871 Enzymes [BR:mree01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      136168871 Transporters [BR:mree02000]  Other transporters   Pores ion channels [TC:1]    136168871 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_C_2 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  136168871 NCBI-ProteinID:  XP_065792663 LinkDB All DBs Position 5:43164295..43167524 Genome browser AA seq 210 aa AA seqDB search MPPYTIVYFPVQGRCEAMRMLLADQDQSWKEEVVAMQTWLQGPLKASCLYGQLPKFQDGD LTLYQSNAILRHLGRTLGLYGKDQREAALVDMVNDGVEDLRCKYISLIYTNYEAGKEDYV KALPQHLKPFETLLSQNKGGQAFIVGDQISFADYNLLDLLRIHQVLAPSCLDSFPLLSAY VARLNSRPKLKAFLASPEHVNRPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccgccctacaccatcgtctacttcccggttcaagggcgctgcgaggccatgcgcatg ctgctggccgaccaggaccagagctggaaggaggaggtggtggccatgcagacctggctg cagggccccctcaaggcctcctgcctgtacgggcagctccccaagttccaggacggagac ctcacgctgtaccagtccaatgccatcctgcgacacctgggccgcaccctcgggctgtat gggaaggaccaacgggaggcggccctggtggacatggtgaatgatggcgtggaggacctt cgctgcaaatacatctccctcatttacaccaactacgaggcgggcaaggaggactatgtg aaggcactgccccagcacctgaagcctttcgagaccctgctgtcccagaacaagggtggc caggccttcatcgtgggcgaccagatctcctttgcggactacaacctgctggacctgctt cggattcaccaggtcctggcccctagctgcctggactccttccccctgctctcagcctac gtggcccgcctcaactcccggcccaagctcaaggcctttctggcctccccggagcacgtg aaccggcccatcaacggcaacgggaaacagtga

DBGET integrated database retrieval system