KEGG   Muntiacus reevesi (Reeves' muntjac): 136168910
Entry
136168910         CDS       T10466                                 
Symbol
HRAS
Name
(RefSeq) GTPase HRas isoform X1
  KO
K02833  GTPase HRas
Organism
mree  Muntiacus reevesi (Reeves' muntjac)
Pathway
mree01521  EGFR tyrosine kinase inhibitor resistance
mree01522  Endocrine resistance
mree04010  MAPK signaling pathway
mree04012  ErbB signaling pathway
mree04014  Ras signaling pathway
mree04015  Rap1 signaling pathway
mree04062  Chemokine signaling pathway
mree04068  FoxO signaling pathway
mree04071  Sphingolipid signaling pathway
mree04072  Phospholipase D signaling pathway
mree04137  Mitophagy - animal
mree04140  Autophagy - animal
mree04144  Endocytosis
mree04150  mTOR signaling pathway
mree04151  PI3K-Akt signaling pathway
mree04210  Apoptosis
mree04211  Longevity regulating pathway
mree04213  Longevity regulating pathway - multiple species
mree04218  Cellular senescence
mree04360  Axon guidance
mree04370  VEGF signaling pathway
mree04371  Apelin signaling pathway
mree04510  Focal adhesion
mree04540  Gap junction
mree04550  Signaling pathways regulating pluripotency of stem cells
mree04625  C-type lectin receptor signaling pathway
mree04630  JAK-STAT signaling pathway
mree04650  Natural killer cell mediated cytotoxicity
mree04660  T cell receptor signaling pathway
mree04662  B cell receptor signaling pathway
mree04664  Fc epsilon RI signaling pathway
mree04714  Thermogenesis
mree04720  Long-term potentiation
mree04722  Neurotrophin signaling pathway
mree04725  Cholinergic synapse
mree04726  Serotonergic synapse
mree04730  Long-term depression
mree04810  Regulation of actin cytoskeleton
mree04910  Insulin signaling pathway
mree04912  GnRH signaling pathway
mree04915  Estrogen signaling pathway
mree04916  Melanogenesis
mree04917  Prolactin signaling pathway
mree04919  Thyroid hormone signaling pathway
mree04921  Oxytocin signaling pathway
mree04926  Relaxin signaling pathway
mree04929  GnRH secretion
mree04933  AGE-RAGE signaling pathway in diabetic complications
mree04935  Growth hormone synthesis, secretion and action
mree05010  Alzheimer disease
mree05022  Pathways of neurodegeneration - multiple diseases
mree05034  Alcoholism
mree05132  Salmonella infection
mree05160  Hepatitis C
mree05161  Hepatitis B
mree05163  Human cytomegalovirus infection
mree05165  Human papillomavirus infection
mree05166  Human T-cell leukemia virus 1 infection
mree05167  Kaposi sarcoma-associated herpesvirus infection
mree05170  Human immunodeficiency virus 1 infection
mree05200  Pathways in cancer
mree05203  Viral carcinogenesis
mree05205  Proteoglycans in cancer
mree05206  MicroRNAs in cancer
mree05207  Chemical carcinogenesis - receptor activation
mree05208  Chemical carcinogenesis - reactive oxygen species
mree05210  Colorectal cancer
mree05211  Renal cell carcinoma
mree05213  Endometrial cancer
mree05214  Glioma
mree05215  Prostate cancer
mree05216  Thyroid cancer
mree05218  Melanoma
mree05219  Bladder cancer
mree05220  Chronic myeloid leukemia
mree05221  Acute myeloid leukemia
mree05223  Non-small cell lung cancer
mree05224  Breast cancer
mree05225  Hepatocellular carcinoma
mree05226  Gastric cancer
mree05230  Central carbon metabolism in cancer
mree05231  Choline metabolism in cancer
mree05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mree05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mree00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    136168910 (HRAS)
   04012 ErbB signaling pathway
    136168910 (HRAS)
   04014 Ras signaling pathway
    136168910 (HRAS)
   04015 Rap1 signaling pathway
    136168910 (HRAS)
   04370 VEGF signaling pathway
    136168910 (HRAS)
   04371 Apelin signaling pathway
    136168910 (HRAS)
   04630 JAK-STAT signaling pathway
    136168910 (HRAS)
   04068 FoxO signaling pathway
    136168910 (HRAS)
   04072 Phospholipase D signaling pathway
    136168910 (HRAS)
   04071 Sphingolipid signaling pathway
    136168910 (HRAS)
   04151 PI3K-Akt signaling pathway
    136168910 (HRAS)
   04150 mTOR signaling pathway
    136168910 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    136168910 (HRAS)
   04140 Autophagy - animal
    136168910 (HRAS)
   04137 Mitophagy - animal
    136168910 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    136168910 (HRAS)
   04218 Cellular senescence
    136168910 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    136168910 (HRAS)
   04540 Gap junction
    136168910 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    136168910 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    136168910 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    136168910 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    136168910 (HRAS)
   04660 T cell receptor signaling pathway
    136168910 (HRAS)
   04662 B cell receptor signaling pathway
    136168910 (HRAS)
   04664 Fc epsilon RI signaling pathway
    136168910 (HRAS)
   04062 Chemokine signaling pathway
    136168910 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    136168910 (HRAS)
   04929 GnRH secretion
    136168910 (HRAS)
   04912 GnRH signaling pathway
    136168910 (HRAS)
   04915 Estrogen signaling pathway
    136168910 (HRAS)
   04917 Prolactin signaling pathway
    136168910 (HRAS)
   04921 Oxytocin signaling pathway
    136168910 (HRAS)
   04926 Relaxin signaling pathway
    136168910 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    136168910 (HRAS)
   04919 Thyroid hormone signaling pathway
    136168910 (HRAS)
   04916 Melanogenesis
    136168910 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    136168910 (HRAS)
   04726 Serotonergic synapse
    136168910 (HRAS)
   04720 Long-term potentiation
    136168910 (HRAS)
   04730 Long-term depression
    136168910 (HRAS)
   04722 Neurotrophin signaling pathway
    136168910 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    136168910 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    136168910 (HRAS)
   04213 Longevity regulating pathway - multiple species
    136168910 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    136168910 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    136168910 (HRAS)
   05206 MicroRNAs in cancer
    136168910 (HRAS)
   05205 Proteoglycans in cancer
    136168910 (HRAS)
   05207 Chemical carcinogenesis - receptor activation
    136168910 (HRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    136168910 (HRAS)
   05203 Viral carcinogenesis
    136168910 (HRAS)
   05230 Central carbon metabolism in cancer
    136168910 (HRAS)
   05231 Choline metabolism in cancer
    136168910 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    136168910 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    136168910 (HRAS)
   05225 Hepatocellular carcinoma
    136168910 (HRAS)
   05226 Gastric cancer
    136168910 (HRAS)
   05214 Glioma
    136168910 (HRAS)
   05216 Thyroid cancer
    136168910 (HRAS)
   05221 Acute myeloid leukemia
    136168910 (HRAS)
   05220 Chronic myeloid leukemia
    136168910 (HRAS)
   05218 Melanoma
    136168910 (HRAS)
   05211 Renal cell carcinoma
    136168910 (HRAS)
   05219 Bladder cancer
    136168910 (HRAS)
   05215 Prostate cancer
    136168910 (HRAS)
   05213 Endometrial cancer
    136168910 (HRAS)
   05224 Breast cancer
    136168910 (HRAS)
   05223 Non-small cell lung cancer
    136168910 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    136168910 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    136168910 (HRAS)
   05161 Hepatitis B
    136168910 (HRAS)
   05160 Hepatitis C
    136168910 (HRAS)
   05163 Human cytomegalovirus infection
    136168910 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    136168910 (HRAS)
   05165 Human papillomavirus infection
    136168910 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    136168910 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    136168910 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    136168910 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    136168910 (HRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    136168910 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    136168910 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    136168910 (HRAS)
   01522 Endocrine resistance
    136168910 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mree04131]
    136168910 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mree04147]
    136168910 (HRAS)
   04031 GTP-binding proteins [BR:mree04031]
    136168910 (HRAS)
Membrane trafficking [BR:mree04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    136168910 (HRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    136168910 (HRAS)
Exosome [BR:mree04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   136168910 (HRAS)
  Exosomal proteins of colorectal cancer cells
   136168910 (HRAS)
GTP-binding proteins [BR:mree04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    136168910 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N CdhD AAA_16
Other DBs
NCBI-GeneID: 136168910
NCBI-ProteinID: XP_065792717
LinkDB
Position
5:48286213..48289240
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINHAKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKARKLSPPDEGGPG
CLSCRCLLS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtataagctcgtggtggtgggcgccggcggcgtggggaagagcgccctgacc
atccagctcatccagaaccacttcgtggatgagtacgaccccaccatcgaggactcctat
cggaagcaagtggtcattgacggggagacatgcctgctggacatcctggacacggcgggc
caggaggagtacagcgccatgcgggaccagtacatgcgcaccggggagggcttcctctgc
gtgtttgccatcaaccacgccaagtccttcgaggacatccaccagtaccgggagcagatc
aagcgggtgaaggactcggacgacgtgcccatggtgctggtggggaacaagtgcgacctg
gccgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctatggcatcccg
tacatcgagacctctgccaagacccgccagggcgtggaggatgcgttctacaccctggtg
cgcgagatccggcagcacaaagcgcgtaagctgagcccgccggacgagggcggccccggc
tgcctgagctgcaggtgcctgctctcctga

DBGET integrated database retrieval system