Muntiacus reevesi (Reeves' muntjac): 136169002 Help Entry 136169002         CDS       T10466                                  Name (RefSeq) histone H3.3C-like   KO K11253   histone H3 Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04613   Neutrophil extracellular trap formation mree05034   Alcoholism mree05202   Transcriptional misregulation in cancer mree05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mree00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     136169002  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     136169002   09163 Immune disease    05322 Systemic lupus erythematosus     136169002   09165 Substance dependence    05034 Alcoholism     136169002  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mree03036]     136169002   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mree04147]     136169002 Chromosome and associated proteins [BR:mree03036]  Eukaryotic type   Nucleosome assembly factors    Histones     136169002 Exosome [BR:mree04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136169002 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Myco_haema Motif Other DBs NCBI-GeneID:  136169002 NCBI-ProteinID:  XP_065792829 LinkDB All DBs Position 5:77408998..77413298 Genome browser AA seq 136 aa AA seqDB search MARTKRTACKSTGGKAPHKQLVIEAAGKSDPSTSGMTRPHRYRPGTVALRQIRPYQKSTH LLIRKLPFQRLVREIAQDFKTDLKFQSAAIRTLQEASEAYLVAFLESKQHSNLARMNSQS KSFPWLEGKRRQLQPM NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccggaccaagaggacagcttgtaaatccacgggtgggaaagcgccccacaaacag ctggtcatcgaagcggccgggaaaagcgacccctctaccagcgggatgacaagacctcat cgctacaggcccgggactgttgccctccgacaaatccgtccttaccagaaatccacccat cttctgattcggaagctgcctttccagaggttggtgagggagatcgcccaggatttcaaa accgacttgaagttccagagtgccgccatccgtacgctgcaggaggctagcgaagcgtac ctggttgcattccttgagtccaaacagcatagtaatctggcaagaatgaactcccagagt aagagctttccatggcttgaaggaaaaaggagacagctacaacccatgtaa

DBGET integrated database retrieval system