Muntiacus reevesi (Reeves' muntjac): 136172215 Help Entry 136172215         CDS       T10466                                  Symbol FGF7 Name (RefSeq) fibroblast growth factor 7   KO K04358   fibroblast growth factor Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04010   MAPK signaling pathway mree04014   Ras signaling pathway mree04015   Rap1 signaling pathway mree04020   Calcium signaling pathway mree04151   PI3K-Akt signaling pathway mree04810   Regulation of actin cytoskeleton mree05200   Pathways in cancer mree05207   Chemical carcinogenesis - receptor activation mree05218   Melanoma mree05224   Breast cancer mree05226   Gastric cancer Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     136172215 (FGF7)    04014 Ras signaling pathway     136172215 (FGF7)    04015 Rap1 signaling pathway     136172215 (FGF7)    04020 Calcium signaling pathway     136172215 (FGF7)    04151 PI3K-Akt signaling pathway     136172215 (FGF7)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     136172215 (FGF7)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136172215 (FGF7)    05207 Chemical carcinogenesis - receptor activation     136172215 (FGF7)   09162 Cancer: specific types    05226 Gastric cancer     136172215 (FGF7)    05218 Melanoma     136172215 (FGF7)    05224 Breast cancer     136172215 (FGF7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mree04052]     136172215 (FGF7)    00536 Glycosaminoglycan binding proteins [BR:mree00536]     136172215 (FGF7) Cytokines and neuropeptides [BR:mree04052]  Cytokines   Growth factors (RTK binding)    136172215 (FGF7) Glycosaminoglycan binding proteins [BR:mree00536]  Heparan sulfate / Heparin   Growth factors/receptors    136172215 (FGF7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Fascin SAND_ULT1 Motif Other DBs NCBI-GeneID:  136172215 NCBI-ProteinID:  XP_065797473 LinkDB All DBs Position 7:complement(58654065..58716066) Genome browser AA seq 194 aa AA seqDB search MRKWILTWILPSLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYME GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEYYLA MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGVPVRGKKTK KEQKTAHFLPMAIT NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atgcgcaaatggatactgacatggatcctgccaagtttgctctacagatcatgcttccac attatctgtctagtgggcactatatctttagcttgcaatgacatgactccagagcaaatg gctacaaatgtgaactgttccagcccggagcgacatacaagaagttatgattacatggaa ggaggagatataagagtgagaagactcttctgtcgaacacagtggtatctgaggattgat aaacgaggcaaagtcaaagggactcaagagatgaagaataattacaacatcatggaaatc aggacagtggctgttggaattgtagcaatcaaaggagtggaaagtgaatattatcttgca atgaacaaggaaggaaagctctatgcaaagaaagaatgcaacgaagactgcaacttcaaa gaattaattctggaaaaccattacaacacatatgcatcagctaaatggacacacagtgga ggagaaatgtttgttgccttaaatcaaaagggggttccagttagagggaaaaaaacgaag aaagaacaaaaaacagcccattttcttcctatggcaataacctaa

DBGET integrated database retrieval system