Muntiacus reevesi (Reeves' muntjac): 136172621 Help Entry 136172621         CDS       T10466                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04613   Neutrophil extracellular trap formation mree05034   Alcoholism mree05202   Transcriptional misregulation in cancer mree05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mree00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     136172621  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     136172621   09163 Immune disease    05322 Systemic lupus erythematosus     136172621   09165 Substance dependence    05034 Alcoholism     136172621  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mree03036]     136172621   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mree04147]     136172621 Chromosome and associated proteins [BR:mree03036]  Eukaryotic type   Nucleosome assembly factors    Histones     136172621 Exosome [BR:mree04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136172621 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa PAF Motif Other DBs NCBI-GeneID:  136172621 NCBI-ProteinID:  XP_065798103 LinkDB All DBs Position 7:45103805..45104552 Genome browser AA seq 137 aa AA seqDB search TVARTNQTARKSTGGKAPRNQLATKAARKSAPSTGGVKKPHHYCTGTEALHEIRRYQKST ELLIRKLPFQRLVREISQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCASHAKRVT IMPKDIQLARRIRGEHA NT seq 414 nt NT seq  +upstreamnt  +downstreamnt accgtggctcgtacaaaccagactgcccgcaaatcgaccggcggtaaagcaccgaggaat caactcgctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacct catcattactgcactggtactgaggcactccatgaaattagacgttatcagaagtccact gaacttctgattcgcaaacttcccttccagcgtctggtgcgggaaatttctcaggacttc aaaacagatctgcgcttccagagcgcagctattggtgctttgcaggaggcaagtgaggcc tatctggttggcctttttgaagacaccaacctgtgtgctagccacgccaaacgtgtaaca attatgccaaaagacatccagctagcacgccgcatacgtggagaacatgcttaa

DBGET integrated database retrieval system